LXL04_027749 | RubberDandelionOmics

Gene overview

LXL04_027749

Reference: OH-1004 Chr: Chr06 Coordinates: 23012147-23012557 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

411 bp · LXL04_027749|LXL04_027749|OH1004|cDNA

ATGAAGAAGAATACCTTCATCTTTCATGCTACAATCTCCCTCTTAATCCTAAACTATCACTTGGTTTGTGATAGTCTCTCTATAACCACAGATCAACAAGCTCTAGAGGCAATCAAAGCTCTAATCACCATCGACCACTCTGGTATCTTATCAAGAAACTGGACTTCCGACACCTCCTTTTGTACCTGGTCAGGAATCTCATGTGATCTTCACTTTCAAACTCAAAGAGTCATCTCTCTAACTCTTCCCAACATGGGTCT...

CDS

Download CDS FASTA

411 bp · LXL04_027749|LXL04_027749|OH1004|CDS

ATGAAGAAGAATACCTTCATCTTTCATGCTACAATCTCCCTCTTAATCCTAAACTATCACTTGGTTTGTGATAGTCTCTCTATAACCACAGATCAACAAGCTCTAGAGGCAATCAAAGCTCTAATCACCATCGACCACTCTGGTATCTTATCAAGAAACTGGACTTCCGACACCTCCTTTTGTACCTGGTCAGGAATCTCATGTGATCTTCACTTTCAAACTCAAAGAGTCATCTCTCTAACTCTTCCCAACATGGGTCT...

Protein

Download Protein FASTA

136 aa · LXL04_027749|LXL04_027749|OH1004|PROTEIN

MKKNTFIFHATISLLILNYHLVCDSLSITTDQQALEAIKALITIDHSGILSRNWTSDTSFCTWSGISCDLHFQTQRVISLTLPNMGLFGKISPSIGNLTFLTFIDFTNNSFHGSIPSEIKNLHHLEKVYMGSNNLT

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_027749`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_027749

Location Chr06:23012147-23012557 (+)

Description Similar to At3g47570: Probable LRR receptor-like serine/threonine-protein kinase At3g47570

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g47570`	Probable LRR receptor-like serine/threonine-protein kinase At3g47570.	No verified direct reference in this release
`At3g47110`	Putative receptor-like protein kinase At3g47110.	No verified direct reference in this release
`At5g05160`	Probable leucine-rich repeat receptor-like protein kinase.	No verified direct reference in this release
`At5g20480`	Constitutes the pattern-recognition receptor (PPR) that determines the specific perception of elongation factor Tu (EF-Tu), a potent elicitor of the defense response to pathogen-associated molecular patterns (PAMPs); phosphorylates BIK1 upon elicitation to regulate immune responses such as defense hormone expression (e.g. jasmonic acid (JA) and salicylic acid (SA)).	No verified direct reference in this release
`At4g20140`	Together with GSO2, receptor-like serine/threonine-kinase required during the development of the epidermal surface in embryos and cotyledons.	GASSHO1 and GASSHO2 encoding a putative leucine-rich repeat transmembrane-type receptor kinase are essential for the normal development of the epidermal surface in Arabidopsis embryos.2008 · DOI: 10.1111/j.1365-313x.2007.03395.x The receptor-like kinases GSO1 and GSO2 together regulate root growth in Arabidopsis through control of cell division and cell fate specification.2014 · DOI: 10.1002/dvdy.24066 A peptide hormone required for Casparian strip diffusion barrier formation in Arabidopsis roots.2017 · DOI: 10.1126/science.aai9057

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027749 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0002237 response to molecule of bacterial origin Biological Process

GO:0002764 immune response-regulating signaling pathway Biological Process

GO:0009611 response to wounding Biological Process

GO:0009617 response to bacterium Biological Process

GO:0009626 plant-type hypersensitive response Biological Process

GO:0009755 hormone-mediated signaling pathway Biological Process

GO:0016045 detection of bacterium Biological Process

GO:0042659 regulation of cell fate specification Biological Process

GO:0045184 establishment of protein localization Biological Process

GO:0051302 regulation of cell division Biological Process

GO:0055075 potassium ion homeostasis Biological Process

GO:0090708 specification of plant organ axis polarity Biological Process

KEGG gene cross-reference

ath:AT3G47110

ath:AT3G47570

ath:AT4G20140

ath:AT5G05160

ath:AT5G20480

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.605

Rank 1 · LXL04_027749 · OH-1004

Endoplasmic reticulum0.129

Rank 2 · LXL04_027749 · OH-1004

Extracellular0.088

Rank 3 · LXL04_027749 · OH-1004

Cytoplasm0.080

Rank 4 · LXL04_027749 · OH-1004

Nucleus0.046

Rank 5 · LXL04_027749 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08263.18LRRNT_230-69 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_027749	`PF08263.18`	LRRNT_2	30	69	1.2e-08	35.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`C0LGP4`	Arabidopsis thaliana	Probable LRR receptor-like serine/threonine-protein kinase At3g47570	41.509%	Swiss-Prot	moderate database homology
`Q9SD62`	Arabidopsis thaliana	Putative receptor-like protein kinase At3g47110	37.288%	Swiss-Prot	moderate database homology
`Q9FHK7`	Arabidopsis thaliana	Probable leucine-rich repeat receptor-like protein kinase At5g05160	34.815%	Swiss-Prot	moderate database homology
`C0LGT6`	Arabidopsis thaliana	LRR receptor-like serine/threonine-protein kinase EFR	37.500%	Swiss-Prot	moderate database homology
`C0LGQ5`	Arabidopsis thaliana	LRR receptor-like serine/threonine-protein kinase GSO1	38.679%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card