LXL04_027512 | RubberDandelionOmics

Gene overview

LXL04_027512

Reference: OH-1004 Chr: Chr06 Coordinates: 17691366-17695996 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2286 bp · LXL04_027512|LXL04_027512|OH1004|cDNA

ATGGAGAGTGTGTTAACTGACTGTGTACAGAATAGTCTGCGACATCTATTATACCGCAATGCAATTTTCATGTGTGAACGCCTTTGCTCTGAGTTTCCCTCAGAGACAAACTTGCAGTTGTTAGCTGCATGTTACTTGCAAAGCAATCAAGCTTACTCGGCTTACCATATTTTAAAAGGAACACAAATGCCTCAGTCCAGATACTTGTTTGCAATATCATGCTTCCAAATGGATCTCCTAAATGAAGCAGAAATGGCATT...

CDS

Download CDS FASTA

2286 bp · LXL04_027512|LXL04_027512|OH1004|CDS

ATGGAGAGTGTGTTAACTGACTGTGTACAGAATAGTCTGCGACATCTATTATACCGCAATGCAATTTTCATGTGTGAACGCCTTTGCTCTGAGTTTCCCTCAGAGACAAACTTGCAGTTGTTAGCTGCATGTTACTTGCAAAGCAATCAAGCTTACTCGGCTTACCATATTTTAAAAGGAACACAAATGCCTCAGTCCAGATACTTGTTTGCAATATCATGCTTCCAAATGGATCTCCTAAATGAAGCAGAAATGGCATT...

Protein

Download Protein FASTA

761 aa · LXL04_027512|LXL04_027512|OH1004|PROTEIN

MESVLTDCVQNSLRHLLYRNAIFMCERLCSEFPSETNLQLLAACYLQSNQAYSAYHILKGTQMPQSRYLFAISCFQMDLLNEAEMALCPSNEPSAEVPNGAAGHYLLGLIYRYTDRMKSAVQQFNQALSLDPLLWAAYEELCKLGAAGEARSVFGESASECIQKQYLTHDMFQSAPVDDRHLAESVSPRHLRLLHGNNNNLKDNNSINQNHNIYPGNPPTATLPNNGIHANISFYNTPSPMANQLSGVAPPPICRNMVPN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_027512`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_027512

Location Chr06:17691366-17695996 (+)

Description Similar to CDC27B: Cell division cycle protein 27 homolog B

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g20000`	Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin-protein ligase complex that controls progression through mitosis and the G1 phase of the cell cycle.	Specialization of CDC27 function in the Arabidopsis thaliana anaphase-promoting complex (APC/C).2008 · DOI: 10.1111/j.1365-313x.2007.03312.x
`At3g16320`	Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin-protein ligase complex that controls progression through mitosis and the G1 phase of the cell cycle.	Specialization of CDC27 function in the Arabidopsis thaliana anaphase-promoting complex (APC/C).2008 · DOI: 10.1111/j.1365-313x.2007.03312.x Overexpression of the Arabidopsis anaphase promoting complex subunit CDC27a increases growth rate and organ size.2009 · DOI: 10.1007/s11103-009-9525-7

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027512 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0007091 metaphase/anaphase transition of mitotic cell cycle Biological Process

GO:0007346 regulation of mitotic cell cycle Biological Process

GO:0009733 response to auxin Biological Process

GO:0010071 root meristem specification Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0030154 cell differentiation Biological Process

GO:0031145 anaphase-promoting complex-dependent catabolic process Biological Process

GO:0048364 root development Biological Process

GO:0048829 root cap development Biological Process

GO:0051301 cell division Biological Process

GO:0051445 regulation of meiotic cell cycle Biological Process

GO:0070936 protein K48-linked ubiquitination Biological Process

KEGG gene cross-reference

ath:AT2G20000

ath:AT3G16320

bta:540660

hsa:996

rno:360643

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.782

Rank 1 · LXL04_027512 · OH-1004

Cytoplasm0.252

Rank 2 · LXL04_027512 · OH-1004

Cell membrane0.034

Rank 3 · LXL04_027512 · OH-1004

Golgi apparatus0.025

Rank 4 · LXL04_027512 · OH-1004

Lysosome / Vacuole0.022

Rank 5 · LXL04_027512 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12895.14ANAPC316-88 aa

PF29407.1CFAP70_TPR_C18-186 aa

PF00515.35TPR_1101-132 aa

PF07719.24TPR_2101-132 aa

PF13181.13TPR_8104-132 aa

PF29407.1CFAP70_TPR_C533-697 aa

PF23914.2TPR_CcmH_CycH535-632 aa

PF00515.35TPR_1536-567 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_027512	`PF12895.14`	ANAPC3	16	88	3.4e-26	92.1
LXL04_027512	`PF29407.1`	CFAP70_TPR_C	18	186	3.2e-15	57.0
LXL04_027512	`PF00515.35`	TPR_1	101	132	9.9e-36	120.8
LXL04_027512	`PF07719.24`	TPR_2	101	132	8e-31	104.3
LXL04_027512	`PF13181.13`	TPR_8	104	132	2.5e-25	87.1
LXL04_027512	`PF29407.1`	CFAP70_TPR_C	533	697	3.2e-15	57.0
LXL04_027512	`PF23914.2`	TPR_CcmH_CycH	535	632	6.5e-10	39.8
LXL04_027512	`PF00515.35`	TPR_1	536	567	9.9e-36	120.8
LXL04_027512	`PF07719.24`	TPR_2	536	566	8e-31	104.3
LXL04_027512	`PF13414.13`	TPR_11	576	616	3.4e-16	59.4
LXL04_027512	`PF13432.13`	TPR_16	576	634	1.2e-13	52.0
LXL04_027512	`PF13424.13`	TPR_12	579	632	2.1e-20	73.4
LXL04_027512	`PF29386.1`	CFAP70_mid_TPR	579	665	6e-06	27.3
LXL04_027512	`PF00515.35`	TPR_1	604	634	9.9e-36	120.8
LXL04_027512	`PF07719.24`	TPR_2	604	634	8e-31	104.3
LXL04_027512	`PF13424.13`	TPR_12	604	663	2.1e-20	73.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8LGU6`	Arabidopsis thaliana	Cell division cycle protein 27 homolog B	66.407%	Swiss-Prot	strong database homology
`Q06AN9`	Arabidopsis thaliana	Cell division cycle protein 27 homolog A	49.035%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card