LXL04_027402 | RubberDandelionOmics

Gene overview

LXL04_027402

Reference: OH-1004 Chr: Chr06 Coordinates: 15000026-15001165 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1050 bp · LXL04_027402|LXL04_027402|OH1004|cDNA

ATGGAAATGGTGGAAAAAGTTCAAAATCAACCTAGAATCCCCGCAGAACTAATAAAGTTGCAGGAAATCGTTGAAAAGGAGGAAAATGATCGAATTAGTGTGTTGCCAGATTGTTTGCTTCTAGAAATCCTCCCTCGCTTATACTCCATAGAAGATGCCATTAGAACAGGTACACTCTCCAAGCGATGGAAACATCTTTGGACCTTGTTACCTACTCTCATTATCAAACAAAATCCCGAGAAGCACCCGTTGTCGGATTT...

CDS

Download CDS FASTA

1050 bp · LXL04_027402|LXL04_027402|OH1004|CDS

ATGGAAATGGTGGAAAAAGTTCAAAATCAACCTAGAATCCCCGCAGAACTAATAAAGTTGCAGGAAATCGTTGAAAAGGAGGAAAATGATCGAATTAGTGTGTTGCCAGATTGTTTGCTTCTAGAAATCCTCCCTCGCTTATACTCCATAGAAGATGCCATTAGAACAGGTACACTCTCCAAGCGATGGAAACATCTTTGGACCTTGTTACCTACTCTCATTATCAAACAAAATCCCGAGAAGCACCCGTTGTCGGATTT...

Protein

Download Protein FASTA

349 aa · LXL04_027402|LXL04_027402|OH1004|PROTEIN

MEMVEKVQNQPRIPAELIKLQEIVEKEENDRISVLPDCLLLEILPRLYSIEDAIRTGTLSKRWKHLWTLLPTLIIKQNPEKHPLSDFVSFIDKTLAQCRQLKLKKFYLQTSEYDCRFEFQVNKWIHYAIKCNVEELSITLWDMDTGDVHQLDQHFLTSSCFTSLKLEFCTFTPTVAISWRNLRSLFINRMKLDEDLIENILSGSPQLETLVLDSCYGFSLLNITSKSVKNLVLAGYNDTDNEYDRDFIIKINAPNILSLT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_027402`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_027402

Location Chr06:15000026-15001165 (-)

Description Similar to At3g28410: Putative F-box/LRR-repeat protein At3g28410

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g28410`	Putative F-box/LRR-repeat protein At3g28410.	No verified direct reference in this release
`At5g02700`	Putative F-box/LRR-repeat protein At5g02700.	No verified direct reference in this release
`At5g03100`	F-box protein At5g03100.	No verified direct reference in this release
`At5g02930`	Putative F-box/LRR-repeat protein At5g02930.	No verified direct reference in this release
`At3g18150`	Putative F-box/LRR-repeat protein At3g18150.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027402 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005777 peroxisome Cellular Component

KEGG gene cross-reference

ath:AT3G18150

ath:AT3G28410

ath:AT5G02700

ath:AT5G02930

ath:AT5G03100

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.831

Rank 1 · LXL04_027402 · OH-1004

Cytoplasm0.243

Rank 2 · LXL04_027402 · OH-1004

Endoplasmic reticulum0.037

Rank 3 · LXL04_027402 · OH-1004

Cell membrane0.034

Rank 4 · LXL04_027402 · OH-1004

Plastid0.016

Rank 5 · LXL04_027402 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23622.2LRR_At1g61320_AtMIF1100-262 aa

PF24758.2LRR_At5g56370122-236 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_027402	`PF23622.2`	LRR_At1g61320_AtMIF1	100	262	5e-16	59.8
LXL04_027402	`PF24758.2`	LRR_At5g56370	122	236	2.9e-13	50.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LSJ3`	Arabidopsis thaliana	Putative F-box/LRR-repeat protein At3g28410	29.305%	Swiss-Prot	weak database homology
`Q9LZ15`	Arabidopsis thaliana	Putative F-box/LRR-repeat protein At5g02700	28.788%	Swiss-Prot	weak database homology
`Q501G5`	Arabidopsis thaliana	F-box protein At5g03100	31.529%	Swiss-Prot	moderate database homology
`Q9LYZ2`	Arabidopsis thaliana	Putative F-box/LRR-repeat protein At5g02930	28.267%	Swiss-Prot	weak database homology
`Q9LV26`	Arabidopsis thaliana	Putative F-box/LRR-repeat protein At3g18150	28.616%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card