LXL04_027240 | RubberDandelionOmics

Gene overview

LXL04_027240

Reference: OH-1004 Chr: Chr06 Coordinates: 11571304-11575906 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1575 bp · LXL04_027240|LXL04_027240|OH1004|cDNA

ATGGAGGAAGACGACGGAGCTCCATCACGGCGGTCATCACCACCGACTCCAAAAAAGATTAAGATGGAGTCGGAAGAACCAAAAGAATCATTAATAAAGGTCAAGGATCATTCCGAAGATGAATCCGAGGAAATTGAAGCTGACGATGAAGAGGAAGATGGATCACCACAGTTACCGCTGTTATTAGACATGATTGACCTTCCACCCTCTTCCCCTTTACCTCCTACTCCGCCTCTTCCGTCTTCACCTAGAGATTTATA...

CDS

Download CDS FASTA

1575 bp · LXL04_027240|LXL04_027240|OH1004|CDS

ATGGAGGAAGACGACGGAGCTCCATCACGGCGGTCATCACCACCGACTCCAAAAAAGATTAAGATGGAGTCGGAAGAACCAAAAGAATCATTAATAAAGGTCAAGGATCATTCCGAAGATGAATCCGAGGAAATTGAAGCTGACGATGAAGAGGAAGATGGATCACCACAGTTACCGCTGTTATTAGACATGATTGACCTTCCACCCTCTTCCCCTTTACCTCCTACTCCGCCTCTTCCGTCTTCACCTAGAGATTTATA...

Protein

Download Protein FASTA

524 aa · LXL04_027240|LXL04_027240|OH1004|PROTEIN

MEEDDGAPSRRSSPPTPKKIKMESEEPKESLIKVKDHSEDESEEIEADDEEEDGSPQLPLLLDMIDLPPSSPLPPTPPLPSSPRDLYMEQQDSEDEGPPPGWDNLYQHKEQVGHIITPAAISAIPSDIKMEDMQEDARNGDGGAPDIVASDIKVEEQDSEDEGPPPGWDSKCQPEPNSQMACPTITQSDVQEDACNGDGPQQRLTISIPSDIKMEEQESEDEGPPPGWDSKCQPELQTPCQTPTITQSDIKTEDVQQEPQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_027240`
TK1151 ID	TkA07G041100
OH-1004 ID	LXL04_027240
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	95.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_027240

Location Chr06:11571304-11575906 (-)

Description Similar to LOL5: Protein LOL5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g21610`	Putative zinc finger that may be involved in programmed cell death and defense response.	No verified direct reference in this release
`At1g32540`	Positive regulator of reactive oxygen-induced cell death.	Antagonistic control of oxidative stress-induced cell death in Arabidopsis by two related, plant-specific zinc finger proteins.2003 · DOI: 10.1073/pnas.1130421100

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0612700`	Involved in plant growth and disease resistance.	No verified direct reference in this release
`Os03g0639600`	Putative zinc finger that may be involved in programmed cell death and defense response.	No verified direct reference in this release
`Os08g0159500`	Negative regulator of programmed cell death and hypersensitive response (HR).	OsLSD1, a rice zinc finger protein, regulates programmed cell death and callus differentiation.2005 · DOI: 10.1094/mpmi-18-0375

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027240 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0009617 response to bacterium Biological Process

GO:0009626 plant-type hypersensitive response Biological Process

GO:0031349 positive regulation of defense response Biological Process

GO:0034052 positive regulation of plant-type hypersensitive response Biological Process

GO:0043068 positive regulation of programmed cell death Biological Process

GO:0045927 positive regulation of growth Biological Process

GO:0098542 defense response to other organism Biological Process

GO:2000121 regulation of removal of superoxide radicals Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0003677 DNA binding Molecular Function

KEGG gene cross-reference

ath:AT1G32540

ath:AT4G21610

dosa:Os01g0612700

dosa:Os03g0639600

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.582

Rank 1 · LXL04_027240 · OH-1004

Cytoplasm0.494

Rank 2 · LXL04_027240 · OH-1004

Cell membrane0.074

Rank 3 · LXL04_027240 · OH-1004

Mitochondrion0.055

Rank 4 · LXL04_027240 · OH-1004

Endoplasmic reticulum0.046

Rank 5 · LXL04_027240 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF06943.18zf-LSD1431-452 aa

PF06943.18zf-LSD1469-492 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_027240	`PF06943.18`	zf-LSD1	431	452	9e-15	55.0
LXL04_027240	`PF06943.18`	zf-LSD1	469	492	9e-15	55.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O65426`	Arabidopsis thaliana	Protein LOL2	41.958%	Swiss-Prot	weak database homology
`Q93ZB1`	Arabidopsis thaliana	Protein LOL1	45.205%	Swiss-Prot	weak database homology
`Q704V3`	Oryza sativa subsp. japonica	Protein LOL5	56.818%	Swiss-Prot	weak database homology
`Q6ASS2`	Oryza sativa subsp. japonica	Protein LOL3	41.111%	Swiss-Prot	weak database homology
`Q0J7V9`	Oryza sativa subsp. japonica	Protein LSD1	43.836%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card