LXL04_027227 | RubberDandelionOmics

Gene overview

LXL04_027227

Reference: OH-1004 Chr: Chr06 Coordinates: 11333781-11338243 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2568 bp · LXL04_027227|LXL04_027227|OH1004|cDNA

ATGATCGTGAGGACCTACGGTCGCCGGAGCAGCAGCAACAGCAACAGTAACAGCAGAAGCAGTAACAACAGTCTGACTTTCGACGACGCAGACGGATTCGACGATTCTTTATCTCAAGAAAGCCCTCAAGAATTAGACAACAGCAACAGCGATATCTTCAGTTTCGCTTTTCCATCTCAAGAATCCATCAAGAACCCTTGGTCTTTTGATTCCGACCCATACAGCTTCGATTCGTCCCAGGATTCGCGTAAATTGGCCGT...

CDS

Download CDS FASTA

2568 bp · LXL04_027227|LXL04_027227|OH1004|CDS

ATGATCGTGAGGACCTACGGTCGCCGGAGCAGCAGCAACAGCAACAGTAACAGCAGAAGCAGTAACAACAGTCTGACTTTCGACGACGCAGACGGATTCGACGATTCTTTATCTCAAGAAAGCCCTCAAGAATTAGACAACAGCAACAGCGATATCTTCAGTTTCGCTTTTCCATCTCAAGAATCCATCAAGAACCCTTGGTCTTTTGATTCCGACCCATACAGCTTCGATTCGTCCCAGGATTCGCGTAAATTGGCCGT...

Protein

Download Protein FASTA

855 aa · LXL04_027227|LXL04_027227|OH1004|PROTEIN

MIVRTYGRRSSSNSNSNSRSSNNSLTFDDADGFDDSLSQESPQELDNSNSDIFSFAFPSQESIKNPWSFDSDPYSFDSSQDSRKLAVLPPRSKKPKTEANEKRKDKKGKKAKKPLMLLTETTTLMETQEFGEMMEHDDEVNFALDGLRRGQPVRIRRASLLSLLMVCGTLQQRRLLRTHGTAKTIIDAVLGLNFDDTPSNLAAAALFFVLTSDGQDDYLLDSPSSIRFLLKLLKPVTTHAAKSKVTTLGSKLVALSKDTS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_027227`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_027227

Location Chr06:11333781-11338243 (-)

Description Similar to WAPL1: Wings apart-like protein 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g11060`	Regulator of sister chromatid cohesion in meiosis which negatively regulates cohesin association with chromatin, acting as an antagonist of CTF7.	The Opposing Actions of Arabidopsis CHROMOSOME TRANSMISSION FIDELITY7 and WINGS APART-LIKE1 and 2 Differ in Mitotic and Meiotic Cells.2016 · DOI: 10.1105/tpc.15.00781
`At1g61030`	Regulator of sister chromatid cohesion in meiosis which negatively regulates cohesin association with chromatin, acting as an antagonist of CTF7.	The Opposing Actions of Arabidopsis CHROMOSOME TRANSMISSION FIDELITY7 and WINGS APART-LIKE1 and 2 Differ in Mitotic and Meiotic Cells.2016 · DOI: 10.1105/tpc.15.00781

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027227 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000070 mitotic sister chromatid segregation Biological Process

GO:0006281 DNA repair Biological Process

GO:0006325 chromatin organization Biological Process

GO:0007059 chromosome segregation Biological Process

GO:0007062 sister chromatid cohesion Biological Process

GO:0007064 mitotic sister chromatid cohesion Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0010789 meiotic sister chromatid cohesion involved in meiosis I Biological Process

GO:0045132 meiotic chromosome segregation Biological Process

GO:0045144 meiotic sister chromatid segregation Biological Process

GO:0051177 meiotic sister chromatid cohesion Biological Process

GO:0051301 cell division Biological Process

KEGG gene cross-reference

ath:AT1G11060

ath:AT1G61030

dme:Dmel_CG3707

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.874

Rank 1 · LXL04_027227 · OH-1004

Cytoplasm0.163

Rank 2 · LXL04_027227 · OH-1004

Cell membrane0.055

Rank 3 · LXL04_027227 · OH-1004

Endoplasmic reticulum0.039

Rank 4 · LXL04_027227 · OH-1004

Golgi apparatus0.017

Rank 5 · LXL04_027227 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07814.19WAPL123-658 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_027227	`PF07814.19`	WAPL	123	658	1.3e-49	169.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4I7C7`	Arabidopsis thaliana	Wings apart-like protein 1	47.752%	Swiss-Prot	moderate database homology
`Q9C951`	Arabidopsis thaliana	Wings apart-like protein 2	47.401%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card