LXL04_027019 | RubberDandelionOmics

Gene overview

LXL04_027019

Reference: OH-1004 Chr: Chr06 Coordinates: 7075784-7079774 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1650 bp · LXL04_027019|LXL04_027019|OH1004|cDNA

ATGGTGATTGTATCAGGTGCGACGGCTACTTGCTCGAAGGAGCATCAAAAAATCTATCAACAATGGTTCAACTATGCCGATTCAGATGGTGATGGGCGGGTAACAGGAGACGATGCAACGAAATTTTTTGCTATGTCGAATATTGAAAAATCCGAACTTAAACAGGTCTGGGCAATTGCAGATACCAAACGTCAAGGATTTTTAGGTTTTAAAGAGTTCATCACTGCTATGCAGTTGCTCTTTTTGGCACAAACAGGAAA...

CDS

Download CDS FASTA

1650 bp · LXL04_027019|LXL04_027019|OH1004|CDS

ATGGTGATTGTATCAGGTGCGACGGCTACTTGCTCGAAGGAGCATCAAAAAATCTATCAACAATGGTTCAACTATGCCGATTCAGATGGTGATGGGCGGGTAACAGGAGACGATGCAACGAAATTTTTTGCTATGTCGAATATTGAAAAATCCGAACTTAAACAGGTCTGGGCAATTGCAGATACCAAACGTCAAGGATTTTTAGGTTTTAAAGAGTTCATCACTGCTATGCAGTTGCTCTTTTTGGCACAAACAGGAAA...

Protein

Download Protein FASTA

549 aa · LXL04_027019|LXL04_027019|OH1004|PROTEIN

MVIVSGATATCSKEHQKIYQQWFNYADSDGDGRVTGDDATKFFAMSNIEKSELKQVWAIADTKRQGFLGFKEFITAMQLLFLAQTGNEITAESLRTGVDLEFLQPPHMEGLDSLLVKNSDSRTNGVQETYGSLTGQLVPPKNLFTSKLNKKTPHHASLGKVTSIIDGLKKLYNEKLKPLEVAYRYNDFASPLLTNSDFDAKPMVMLLGQYSTGKTTFIKHILKTNYPGAHIGPEPTTDRFIVVMGGPDDRSVPGNTIAVQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_027019`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_027019

Location Chr06:7075784-7079774 (+)

Description Similar to EHD1: EH domain-containing protein 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g20290`	Involved in endocytosis positive regulation.	AtEHDs, novel Arabidopsis EH-domain-containing proteins involved in endocytosis.2008 · DOI: 10.1111/j.1365-313x.2008.03571.x EHD1 functions in endosomal recycling and confers salt tolerance.2013 · DOI: 10.1371/journal.pone.0054533
`At4g05520`	Involved in endocytosis negative regulation, probably by influencing actin organization.	AtEHDs, novel Arabidopsis EH-domain-containing proteins involved in endocytosis.2008 · DOI: 10.1111/j.1365-313x.2008.03571.x The coiled-coil domain of EHD2 mediates inhibition of LeEix2 endocytosis and signaling.2009 · DOI: 10.1371/journal.pone.0007973

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027019 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006886 intracellular protein transport Biological Process

GO:0006897 endocytosis Biological Process

GO:0006907 pinocytosis Biological Process

GO:0010886 positive regulation of cholesterol storage Biological Process

GO:0016197 endosomal transport Biological Process

GO:0030100 regulation of endocytosis Biological Process

GO:0032456 endocytic recycling Biological Process

GO:0032956 regulation of actin cytoskeleton organization Biological Process

GO:0034383 low-density lipoprotein particle clearance Biological Process

GO:0042538 hyperosmotic salinity response Biological Process

GO:0042632 cholesterol homeostasis Biological Process

GO:0050731 positive regulation of peptidyl-tyrosine phosphorylation Biological Process

KEGG gene cross-reference

ath:AT3G20290

ath:AT4G05520

hsa:30844

mmu:98878

rno:293692

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.567

Rank 1 · LXL04_027019 · OH-1004

Cell membrane0.262

Rank 2 · LXL04_027019 · OH-1004

Nucleus0.184

Rank 3 · LXL04_027019 · OH-1004

Golgi apparatus0.120

Rank 4 · LXL04_027019 · OH-1004

Endoplasmic reticulum0.095

Rank 5 · LXL04_027019 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12763.14EH14-88 aa

PF13499.13EF-hand_717-78 aa

PF16880.11EHD_N167-199 aa

PF00350.30Dynamin_N204-364 aa

PF01926.30MMR_HSR1204-363 aa

PF18150.7DUF5600439-540 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_027019	`PF12763.14`	EH	14	88	9.7e-12	45.4
LXL04_027019	`PF13499.13`	EF-hand_7	17	78	1.9e-07	32.0
LXL04_027019	`PF16880.11`	EHD_N	167	199	2.2e-16	60.2
LXL04_027019	`PF00350.30`	Dynamin_N	204	364	6.3e-15	56.3
LXL04_027019	`PF01926.30`	MMR_HSR1	204	363	7.1e-09	36.5
LXL04_027019	`PF18150.7`	DUF5600	439	540	1e-37	129.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q94CF0`	Arabidopsis thaliana	EH domain-containing protein 1	74.234%	Swiss-Prot	strong database homology
`B3LF48`	Arabidopsis thaliana	EH domain-containing protein 2	73.112%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card