LXL04_025930 | RubberDandelionOmics

Gene overview

LXL04_025930

Reference: OH-1004 Chr: Chr05 Coordinates: 118657939-118658403 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

369 bp · LXL04_025930|LXL04_025930|OH1004|cDNA

ATGCTATCTAATTCAGCTCCTTGGTCAACGGGAAACAAAGATATGTCGTCGATTACTTCAAGATCGGCGGAGTGTATAACCTCAAAAGCATTTCCGATAAACCCCGCAACGGGAAACACGTATCTTGCGACCTCCGTGATGCACGCCGATTTCTGGTCATTTGCTGAAATCATGTTTCAAAATTGGGAGGACACCGTCCAATCTTGGCACATCGATAGCTACTCGTTCTTCGTTGTTGGGATGGACGGCGGGCAGTGGAC...

CDS

Download CDS FASTA

369 bp · LXL04_025930|LXL04_025930|OH1004|CDS

ATGCTATCTAATTCAGCTCCTTGGTCAACGGGAAACAAAGATATGTCGTCGATTACTTCAAGATCGGCGGAGTGTATAACCTCAAAAGCATTTCCGATAAACCCCGCAACGGGAAACACGTATCTTGCGACCTCCGTGATGCACGCCGATTTCTGGTCATTTGCTGAAATCATGTTTCAAAATTGGGAGGACACCGTCCAATCTTGGCACATCGATAGCTACTCGTTCTTCGTTGTTGGGATGGACGGCGGGCAGTGGAC...

Protein

Download Protein FASTA

122 aa · LXL04_025930|LXL04_025930|OH1004|PROTEIN

MLSNSAPWSTGNKDMSSITSRSAECITSKAFPINPATGNTYLATSVMHADFWSFAEIMFQNWEDTVQSWHIDSYSFFVVGMDGGQWTPGSRTRYNLRDTVTSGCGTSDRRIGVGSIWGNNFT

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_025930`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_025930

Location Chr05:118657939-118658403 (+)

Description Similar to SKU5: Monocopper oxidase-like protein SKU5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g12420`	May be a monocopper oxidase of unknown specificity.	No verified direct reference in this release
`At1g55560`	Probable oxidoreductase that may be involved in pollen tube growth.	Two Arabidopsis late pollen transcripts are detected in cytoplasmic granules.2017 · DOI: 10.1002/pld3.12
`At4g25240`	Monocopper oxidase-like protein SKS1.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025930 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009932 cell tip growth Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0016020 membrane Cellular Component

GO:0048046 apoplast Cellular Component

GO:0098552 side of membrane Cellular Component

GO:0005507 copper ion binding Molecular Function

GO:0016491 oxidoreductase activity Molecular Function

KEGG gene cross-reference

ath:AT1G55560

ath:AT4G12420

ath:AT4G25240

bna:106452325

nta:107766889

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.972

Rank 1 · LXL04_025930 · OH-1004

Cytoplasm0.018

Rank 2 · LXL04_025930 · OH-1004

Cell membrane0.014

Rank 3 · LXL04_025930 · OH-1004

Endoplasmic reticulum0.007

Rank 4 · LXL04_025930 · OH-1004

Mitochondrion0.006

Rank 5 · LXL04_025930 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07731.21Cu-oxidase_229-100 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_025930	`PF07731.21`	Cu-oxidase_2	29	100	2.1e-13	50.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SU40`	Arabidopsis thaliana	Monocopper oxidase-like protein SKU5	46.154%	Swiss-Prot	moderate database homology
`Q9SMW3`	Arabidopsis thaliana	Protein SKU5 SIMILAR 14	42.169%	Swiss-Prot	moderate database homology
`Q8VXX5`	Arabidopsis thaliana	Monocopper oxidase-like protein SKS1	39.437%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card