LXL04_025355 | RubberDandelionOmics

Gene overview

LXL04_025355

Reference: OH-1004 Chr: Chr05 Coordinates: 110261228-110263790 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1881 bp · LXL04_025355|LXL04_025355|OH1004|cDNA

ATGATGTTCAGATCCAAAATCAAATGGGTGGCACTTGGGGGCCTGGTTTTGTCATTTTTGTCTTTGCTGGTGCACATGTTTCTTGCAAATACAAGTGTGGAGCTAGTACAATACAGTGTCATGACACAATTTATTGAGGATCTGAATATAGATGTCGTGGGGAAACAGAGTGTCAGATCTAAAAAGTTGTGGAAAAAGGTCAAGTCTTTAGAGGTTTTGCAGCCATATGCAAACCCTAGAAGTATATATCCTGTTCCAGT...

CDS

Download CDS FASTA

1881 bp · LXL04_025355|LXL04_025355|OH1004|CDS

ATGATGTTCAGATCCAAAATCAAATGGGTGGCACTTGGGGGCCTGGTTTTGTCATTTTTGTCTTTGCTGGTGCACATGTTTCTTGCAAATACAAGTGTGGAGCTAGTACAATACAGTGTCATGACACAATTTATTGAGGATCTGAATATAGATGTCGTGGGGAAACAGAGTGTCAGATCTAAAAAGTTGTGGAAAAAGGTCAAGTCTTTAGAGGTTTTGCAGCCATATGCAAACCCTAGAAGTATATATCCTGTTCCAGT...

Protein

Download Protein FASTA

626 aa · LXL04_025355|LXL04_025355|OH1004|PROTEIN

MMFRSKIKWVALGGLVLSFLSLLVHMFLANTSVELVQYSVMTQFIEDLNIDVVGKQSVRSKKLWKKVKSLEVLQPYANPRSIYPVPVEQNNGFIYAKVFGEFEKIRSSICDLVAISRLLNATLVIPEIQESTSSKGISSEFKSFSYLYNEEQFITSLKNDVIIVKSLPTKLKDARKRKEFPTFKPKKTASPDYYIKQLLPELKKSKVIGLVVMDGGCLQPILSSKFVEYQRLRCRVAFHALHFRPEILSLANLIVQRLRA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_025355`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_025355

Location Chr05:110261228-110263790 (+)

Description Similar to EDA30: Protein EMBRYO SAC DEVELOPMENT ARREST 30

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g03810`	Protein EMBRYO SAC DEVELOPMENT ARREST 30.	No verified direct reference in this release
`At3g30300`	O-fucosyltransferase 27.	No verified direct reference in this release
`At1g04910`	O-fucosyltransferase 1.	No verified direct reference in this release
`At5g64600`	O-fucosyltransferase 38.	No verified direct reference in this release
`At1g11990`	O-fucosyltransferase 2.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025355 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006004 fucose metabolic process Biological Process

GO:0010197 polar nucleus fusion Biological Process

GO:0048868 pollen tube development Biological Process

GO:0000138 Golgi trans cisterna Cellular Component

GO:0000139 Golgi membrane Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005768 endosome Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005802 trans-Golgi network Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT1G04910

ath:AT3G03810

ath:AT3G30300

ath:AT5G64600

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.743

Rank 1 · LXL04_025355 · OH-1004

Cell membrane0.093

Rank 2 · LXL04_025355 · OH-1004

Endoplasmic reticulum0.086

Rank 3 · LXL04_025355 · OH-1004

Cytoplasm0.062

Rank 4 · LXL04_025355 · OH-1004

Extracellular0.059

Rank 5 · LXL04_025355 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF10250.16O-FucT94-388 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_025355	`PF10250.16`	O-FucT	94	388	4.2e-71	241.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4J2C8`	Arabidopsis thaliana	Protein EMBRYO SAC DEVELOPMENT ARREST 30	58.485%	Swiss-Prot	strong database homology
`Q8GZ81`	Arabidopsis thaliana	O-fucosyltransferase 27	47.549%	Swiss-Prot	moderate database homology
`Q8W486`	Arabidopsis thaliana	O-fucosyltransferase 1	32.927%	Swiss-Prot	moderate database homology
`F4KF16`	Arabidopsis thaliana	O-fucosyltransferase 38	33.228%	Swiss-Prot	moderate database homology
`F4IAL1`	Arabidopsis thaliana	O-fucosyltransferase 2	34.024%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card