LXL04_025227 | RubberDandelionOmics

Gene overview

LXL04_025227

Reference: OH-1004 Chr: Chr05 Coordinates: 108202546-108220785 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3249 bp · LXL04_025227|LXL04_025227|OH1004|cDNA

ATGACTAAAGATGGTAAGGATGATAAGGATGGTAGTGGTTCTGGTTCCAATAAAGAAAATGATAGGCATGGTTTAGATCTTGATAATCCTCTTGTCCTTCACTCCAACAACCTTAGTTGTGTATCCATTGTTAACTTCAAACTCCAGGGTACTACGAATTACAAAGTTTGGTCTAGTACCACTGAGTTAAGTCTCAGGGCCAGAAACAAACTTGGATTTGTTAATGGTACTTTTCCCCGTCCCACAGAGGATGAGTCTAA...

CDS

Download CDS FASTA

3249 bp · LXL04_025227|LXL04_025227|OH1004|CDS

ATGACTAAAGATGGTAAGGATGATAAGGATGGTAGTGGTTCTGGTTCCAATAAAGAAAATGATAGGCATGGTTTAGATCTTGATAATCCTCTTGTCCTTCACTCCAACAACCTTAGTTGTGTATCCATTGTTAACTTCAAACTCCAGGGTACTACGAATTACAAAGTTTGGTCTAGTACCACTGAGTTAAGTCTCAGGGCCAGAAACAAACTTGGATTTGTTAATGGTACTTTTCCCCGTCCCACAGAGGATGAGTCTAA...

Protein

Download Protein FASTA

1082 aa · LXL04_025227|LXL04_025227|OH1004|PROTEIN

MTKDGKDDKDGSGSGSNKENDRHGLDLDNPLVLHSNNLSCVSIVNFKLQGTTNYKVWSSTTELSLRARNKLGFVNGTFPRPTEDESKMRQWDRADAVVLSWLLGINSYTQGSDSLSDYYNKLNSLWKEFDSLTNLGICTCDAFTSVSDHSQQIKLMHFLMGLDESYSTIRSNILMHDPFPSVKSAFATSSREESYRMSSSMSTPNKVPNSAFFGKINDKKRSPNSNTSNNNRSNLGFNPVASMAGVNLSFLHHDIKWVID...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_025227`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_025227

Location Chr05:108202546-108220785 (+)

Description Similar to RE1: Retrovirus-related Pol polyprotein from transposon RE1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`UniProt: Q94HW2`	Retrovirus-related Pol polyprotein from transposon RE1.	No verified direct reference in this release
`At4g02960`	Retrovirus-related Pol polyprotein from transposon RE2.	No verified direct reference in this release
`UniProt: P92519`	Uncharacterized mitochondrial protein AtMg00810.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025227 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006310 DNA recombination Biological Process

GO:0006508 proteolysis Biological Process

GO:0015074 DNA integration Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0003676 nucleic acid binding Molecular Function

GO:0003964 RNA-directed DNA polymerase activity Molecular Function

GO:0004190 aspartic-type endopeptidase activity Molecular Function

GO:0004519 endonuclease activity Molecular Function

GO:0008270 zinc ion binding Molecular Function

KEGG gene cross-reference No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.594

Rank 1 · LXL04_025227 · OH-1004

Nucleus0.400

Rank 2 · LXL04_025227 · OH-1004

Mitochondrion0.071

Rank 3 · LXL04_025227 · OH-1004

Endoplasmic reticulum0.042

Rank 4 · LXL04_025227 · OH-1004

Peroxisome0.040

Rank 5 · LXL04_025227 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14244.13Retrotran_gag_341-81 aa

PF07727.20RVT_2533-635 aa

PF07727.20RVT_2636-712 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_025227	`PF14244.13`	Retrotran_gag_3	41	81	6.7e-09	36.1
LXL04_025227	`PF07727.20`	RVT_2	533	635	1.3e-50	173.0
LXL04_025227	`PF07727.20`	RVT_2	636	712	1.3e-50	173.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q94HW2`	Arabidopsis thaliana	Retrovirus-related Pol polyprotein from transposon RE1	44.194%	Swiss-Prot	weak database homology
`Q9ZT94`	Arabidopsis thaliana	Retrovirus-related Pol polyprotein from transposon RE2	43.226%	Swiss-Prot	weak database homology
`P92519`	Arabidopsis thaliana	Uncharacterized mitochondrial protein AtMg00810	46.087%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card