LXL04_025091 | RubberDandelionOmics

Gene overview

LXL04_025091

Reference: OH-1004 Chr: Chr05 Coordinates: 105803249-105810085 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

5013 bp · LXL04_025091|LXL04_025091|OH1004|cDNA

ACGTATAAATTATCGGCCACCGCGAACAGGAGGGCAAAGCCGTCGGAGACTAAATGTAGTAAACAACAGTCGTACCTAAGCCTAAAACCCTCCCATTTTTCCTGCCGGTTCGACACAATTGAATTTGGGGACGACGACGACGATAAAGATTCACTTCAATTGATTCGATATATGTTCAGAGCTCCGACAGttagtggtggtggtggtgtacCTTTAACTTCCATCACCACTCAATCACCAAACCCGGCAGATATGGGGGA...

CDS

Download CDS FASTA

4854 bp · LXL04_025091|LXL04_025091|OH1004|CDS

TTGATTCGATATATGTTCAGAGCTCCGACAGTTAGTGGTGGTGGTGGTGTACCTTTAACTTCCATCACCACTCAATCACCAAACCCGGCAGATATGGGGGATCAGAGTCACCACCGAGCCGCCGCTTCCAGGGCTTTCCAGTTCCACCCGGCACGACCAGCTATCATCGACCTCTTCAATCTATACCTTGGTAGAAGTGGCCGCGAAAAGTCAGACGATTTGGTCCGAGAACCTCCGAACAAGACACAGAAACGAGTTAC...

Protein

Download Protein FASTA

1617 aa · LXL04_025091|LXL04_025091|OH1004|PROTEIN

MIRYMFRAPTVSGGGGVPLTSITTQSPNPADMGDQSHHRAAASRAFQFHPARPAIIDLFNLYLGRSGREKSDDLVREPPNKTQKRVTALNRDLPPRNEQFLLDFEQLQNQFPDREQLRTVSESVLISLVIQCSNHAPRAEFILFALRNLYNIGYINWDTFLPSLLSSVSSAEMSVSISSTASPPPPVTSTSISQTGMLPSSTTIPNSSNFQSSSPASPLISVHGIGSPSQSANEPSTTAISPVKSSDMNNNSSHLSRTNV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_025091`
TK1151 ID	TkA06G080980
OH-1004 ID	LXL04_025091
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.200
Protein coverage (%)	TK1151 96.836 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_025091

Location Chr05:105803249-105810085 (+)

Description Similar to MED23: Mediator of RNA polymerase II transcription subunit 23

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g23230`	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025091 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0010628 positive regulation of gene expression Biological Process

GO:0043473 pigmentation Biological Process

GO:0005634 nucleus Cellular Component

GO:0005667 transcription regulator complex Cellular Component

GO:0016592 mediator complex Cellular Component

KEGG gene cross-reference

ath:AT1G23230

ddi:DDB_G0270434

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.481

Rank 1 · LXL04_025091 · OH-1004

Cytoplasm0.434

Rank 2 · LXL04_025091 · OH-1004

Mitochondrion0.057

Rank 3 · LXL04_025091 · OH-1004

Golgi apparatus0.051

Rank 4 · LXL04_025091 · OH-1004

Cell membrane0.044

Rank 5 · LXL04_025091 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF11573.14Med23526-1332 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_025091	`PF11573.14`	Med23	526	1332	4.1e-27	95.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4I4P3`	Arabidopsis thaliana	Mediator of RNA polymerase II transcription subunit 23	66.891%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card