LXL04_024958 | RubberDandelionOmics

Gene overview

LXL04_024958

Reference: OH-1004 Chr: Chr05 Coordinates: 102766619-102768004 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

543 bp · LXL04_024958|LXL04_024958|OH1004|cDNA

ATGTATTACTATGAAGTTATTGGATTatatgaaaaatatgaaacaaCGACTACTTCCCTTGATATTCCACATGAGGTGTGCAAATACTCTGTTCTCATAGAGGCATTAGTTGCTAAAGTTACCAAGGGGTTTAGCCATCGATTAGCCCCATTGAACATGTTTGTGAAAGAACTTAGTGACAGCATGCAACTTTCCAAAATTGAACATGAAGAAACTCAGGGATATGGTGGtaagaagagaaagaaaaacaACGATGGTGG...

CDS

Download CDS FASTA

543 bp · LXL04_024958|LXL04_024958|OH1004|CDS

ATGTATTACTATGAAGTTATTGGATTATATGAAAAATATGAAACAACGACTACTTCCCTTGATATTCCACATGAGGTGTGCAAATACTCTGTTCTCATAGAGGCATTAGTTGCTAAAGTTACCAAGGGGTTTAGCCATCGATTAGCCCCATTGAACATGTTTGTGAAAGAACTTAGTGACAGCATGCAACTTTCCAAAATTGAACATGAAGAAACTCAGGGATATGGTGGTAAGAAGAGAAAGAAAAACAACGATGGTGG...

Protein

Download Protein FASTA

180 aa · LXL04_024958|LXL04_024958|OH1004|PROTEIN

MYYYEVIGLYEKYETTTTSLDIPHEVCKYSVLIEALVAKVTKGFSHRLAPLNMFVKELSDSMQLSKIEHEETQGYGGKKRKKNNDGGENSKPRDVVHVRAKRGEATYSHSLAERMRREKINEKLRRLQDRSDDGNVSDVGGNNQLRAIIAESDRCLIGKYPFKRSTQSSSHEVIAPAGVK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_024958`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_024958

Location Chr05:102766619-102768004 (+)

Description Similar to BHLH75: Transcription factor bHLH75

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g25330`	Transcription factor bHLH75.	No verified direct reference in this release
`At5g50915`	Transcription factor bHLH137.	No verified direct reference in this release
`At3g07340`	Transcription factor bHLH62.	No verified direct reference in this release
`At5g48560`	Transcription factor that binds DNA to G box 5'-CACGTG-3' and to E-box 5'-CANNTG-3' (By similarity).	Multiple bHLH proteins form heterodimers to mediate CRY2-dependent regulation of flowering-time in Arabidopsis.2013 · DOI: 10.1371/journal.pgen.1003861

Rice

Reference gene ID	Possible function	Papers / DOI
`Os09g0510500`	Transcription activator that contributes, together with LO9-177 and ILI5/BUL1, to the promotion of leaf inclination and grain size by modulating cell elongation.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024958 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009637 response to blue light Biological Process

GO:0009739 response to gibberellin Biological Process

GO:0016036 cellular response to phosphate starvation Biological Process

GO:0042127 regulation of cell population proliferation Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0051511 negative regulation of unidimensional cell growth Biological Process

GO:0071368 cellular response to cytokinin stimulus Biological Process

GO:2000024 regulation of leaf development Biological Process

GO:2000488 positive regulation of brassinosteroid biosynthetic process Biological Process

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT1G25330

ath:AT3G07340

ath:AT5G48560

ath:AT5G50915

dosa:Os09g0510500

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.902

Rank 1 · LXL04_024958 · OH-1004

Cytoplasm0.155

Rank 2 · LXL04_024958 · OH-1004

Cell membrane0.041

Rank 3 · LXL04_024958 · OH-1004

Endoplasmic reticulum0.024

Rank 4 · LXL04_024958 · OH-1004

Mitochondrion0.015

Rank 5 · LXL04_024958 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`A4D998`	Arabidopsis thaliana	Transcription factor bHLH75	75.556%	Swiss-Prot	weak database homology
`Q93W88`	Arabidopsis thaliana	Transcription factor bHLH137	56.140%	Swiss-Prot	weak database homology
`Q9SRT2`	Arabidopsis thaliana	Transcription factor bHLH62	47.436%	Swiss-Prot	weak database homology
`Q9FJL4`	Arabidopsis thaliana	Transcription factor bHLH78	58.333%	Swiss-Prot	weak database homology
`Q0J0G7`	Oryza sativa subsp. japonica	Transcription factor BC1	56.604%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card