LXL04_024313 | RubberDandelionOmics

Gene overview

LXL04_024313

Reference: OH-1004 Chr: Chr05 Coordinates: 87166263-87166529 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

267 bp · LXL04_024313|LXL04_024313|OH1004|cDNA

ATGCAGTTTAAAATGGTTAGGTTGCATAGAACCCTTTTGTGTTGTGTCTTTATCATCTTACTTGTGCAAACTAGTGAAGCGAGAAAGCTAGTTGAAAACTTGAAATGTACAAAGAAATACGACGAGGTCAAGCATGTGAACGAAGCCAATGGAGTATCAAATCCTGGCGACGTTCCATCTCCATATGTCGATGCTTTTCGGCCTACTAAACCAGGGCATAGCCCCGGTGTCGGCCATTCCATTCACGAGTTAGAAGAACA...

CDS

Download CDS FASTA

267 bp · LXL04_024313|LXL04_024313|OH1004|CDS

ATGCAGTTTAAAATGGTTAGGTTGCATAGAACCCTTTTGTGTTGTGTCTTTATCATCTTACTTGTGCAAACTAGTGAAGCGAGAAAGCTAGTTGAAAACTTGAAATGTACAAAGAAATACGACGAGGTCAAGCATGTGAACGAAGCCAATGGAGTATCAAATCCTGGCGACGTTCCATCTCCATATGTCGATGCTTTTCGGCCTACTAAACCAGGGCATAGCCCCGGTGTCGGCCATTCCATTCACGAGTTAGAAGAACA...

Protein

Download Protein FASTA

88 aa · LXL04_024313|LXL04_024313|OH1004|PROTEIN

MQFKMVRLHRTLLCCVFIILLVQTSEARKLVENLKCTKKYDEVKHVNEANGVSNPGDVPSPYVDAFRPTKPGHSPGVGHSIHELEEHP

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_024313`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_024313

Location Chr05:87166263-87166529 (-)

Description Similar to CEP3: Precursor of CEP3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g23440`	Extracellular signaling peptide that represses primary root growth rate and significantly inhibits lateral root formation.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024313 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006970 response to osmotic stress Biological Process

GO:0006995 cellular response to nitrogen starvation Biological Process

GO:0009266 response to temperature stimulus Biological Process

GO:0009642 response to light intensity Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009733 response to auxin Biological Process

GO:0009744 response to sucrose Biological Process

GO:0010037 response to carbon dioxide Biological Process

GO:0035864 response to potassium ion Biological Process

GO:0048364 root development Biological Process

GO:0048831 regulation of shoot system development Biological Process

GO:0090548 response to nitrate starvation Biological Process

KEGG gene cross-reference

ath:AT2G23440

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.738

Rank 1 · LXL04_024313 · OH-1004

Endoplasmic reticulum0.137

Rank 2 · LXL04_024313 · OH-1004

Cell membrane0.119

Rank 3 · LXL04_024313 · OH-1004

Cytoplasm0.050

Rank 4 · LXL04_024313 · OH-1004

Golgi apparatus0.036

Rank 5 · LXL04_024313 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF30920.1CEP_precursor8-83 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_024313	`PF30920.1`	CEP_precursor	8	83	5.6e-12	46.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O80460`	Arabidopsis thaliana	Precursor of CEP3	34.940%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card