LXL04_024124 | RubberDandelionOmics

Gene overview

LXL04_024124

Reference: OH-1004 Chr: Chr05 Coordinates: 81655567-81656003 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

372 bp · LXL04_024124|LXL04_024124|OH1004|cDNA

ATGCCGATTAAGATATGCTATCCCGCAATTGAAAGCCACGGATGGAGAATCGTTACTGGTTGCGATCCTAAAAACACCAGATGGAGTTACCACAACCGCGGATCTTGGCCAGTTGCAGTGCTTTTATGGTTGCTAACGGCGGCGTGTAACAAAACGACGGCGTGTAACAAAACGGGGCGGCCACAGATAGCGAgaaaggcaattgaactggcGGAGAGCCGCCTGTTGAAGGACGGATGGCCGGAATATTACGACGGAAA...

CDS

Download CDS FASTA

372 bp · LXL04_024124|LXL04_024124|OH1004|CDS

ATGCCGATTAAGATATGCTATCCCGCAATTGAAAGCCACGGATGGAGAATCGTTACTGGTTGCGATCCTAAAAACACCAGATGGAGTTACCACAACCGCGGATCTTGGCCAGTTGCAGTGCTTTTATGGTTGCTAACGGCGGCGTGTAACAAAACGACGGCGTGTAACAAAACGGGGCGGCCACAGATAGCGAGAAAGGCAATTGAACTGGCGGAGAGCCGCCTGTTGAAGGACGGATGGCCGGAATATTACGACGGAAA...

Protein

Download Protein FASTA

123 aa · LXL04_024124|LXL04_024124|OH1004|PROTEIN

MPIKICYPAIESHGWRIVTGCDPKNTRWSYHNRGSWPVAVLLWLLTAACNKTTACNKTGRPQIARKAIELAESRLLKDGWPEYYDGKLGRYRTSGSKRGSIRHGRLRGIWWRRCCWKIRHIWG

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_024124`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_024124

Location Chr05:81655567-81656003 (-)

Description Similar to CINV1: Cytosolic invertase 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g22650`	Invertase that cleaves sucrose into glucose and fructose.	No verified direct reference in this release
`At4g34860`	Invertase that cleaves sucrose into glucose and fructose.	No verified direct reference in this release
`At1g72000`	Invertase that cleaves sucrose into glucose and fructose.	No verified direct reference in this release
`At4g09510`	Cytosolic invertase that may cleave sucrose into glucose and fructose, and that is involved in the regulation of root growth.	Normal growth of Arabidopsis requires cytosolic invertase but not sucrose synthase.2009 · DOI: 10.1073/pnas.0900689106

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0550600`	Cytosolic invertase that cleaves sucrose into glucose and fructose and is involved in the regulation of primary root elongation, lateral root formation, floral transition and pollen development.	OsCYT-INV1 for alkaline/neutral invertase is involved in root cell development and reproductivity in rice (Oryza sativa L.).2008 · DOI: 10.1007/s00425-008-0718-0

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024124 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0005987 sucrose catabolic process Biological Process

GO:0009555 pollen development Biological Process

GO:0010311 lateral root formation Biological Process

GO:0048364 root development Biological Process

GO:0048510 regulation of timing of transition from vegetative to reproductive phase Biological Process

GO:0080022 primary root development Biological Process

GO:0005634 nucleus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0004564 beta-fructofuranosidase activity Molecular Function

GO:0004575 sucrose alpha-glucosidase activity Molecular Function

GO:0033926 endo-alpha-N-acetylgalactosaminidase activity Molecular Function

KEGG gene cross-reference

ath:AT1G22650

ath:AT1G72000

ath:AT4G09510

ath:AT4G34860

dosa:Os02g0550600

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.521

Rank 1 · LXL04_024124 · OH-1004

Mitochondrion0.194

Rank 2 · LXL04_024124 · OH-1004

Cytoplasm0.122

Rank 3 · LXL04_024124 · OH-1004

Nucleus0.080

Rank 4 · LXL04_024124 · OH-1004

Peroxisome0.033

Rank 5 · LXL04_024124 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12899.14Glyco_hydro_1001-92 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_024124	`PF12899.14`	Glyco_hydro_100	1	92	3e-37	129.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4I2X9`	Arabidopsis thaliana	Probable alkaline/neutral invertase D	80.220%	Swiss-Prot	strong database homology
`Q9SW48`	Arabidopsis thaliana	Probable alkaline/neutral invertase B	74.490%	Swiss-Prot	strong database homology
`Q9C560`	Arabidopsis thaliana	Probable alkaline/neutral invertase F	79.121%	Swiss-Prot	strong database homology
`Q67XD9`	Arabidopsis thaliana	Alkaline/neutral invertase CINV2	76.923%	Swiss-Prot	strong database homology
`Q69T31`	Oryza sativa subsp. japonica	Cytosolic invertase 1	82.418%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card