LXL04_024108 | RubberDandelionOmics

Gene overview

LXL04_024108

Reference: OH-1004 Chr: Chr05 Coordinates: 81250643-81251629 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

987 bp · LXL04_024108|LXL04_024108|OH1004|cDNA

ATGGAGACAACCCAACCTACTCTTCCCAAGTACTTGCAGAATTCTCAAGTGTCTCAAGAGTTCAAGGATCTCACTTCCAGTTTGCCCAAAAACAGAGGGTGGGTTATACCTATCGTACACCAATACCAAGGTTTCTGGCATCATGATTGGCAACTCCAAGGAGTTCTCTCATATCAAAAACATTTTCAAGCACAAGACACCGATATCCTACTTGTTACCACACCAAAATCTGGCACCACCTGGTTAAAAGCAATCTCTTT...

CDS

Download CDS FASTA

987 bp · LXL04_024108|LXL04_024108|OH1004|CDS

ATGGAGACAACCCAACCTACTCTTCCCAAGTACTTGCAGAATTCTCAAGTGTCTCAAGAGTTCAAGGATCTCACTTCCAGTTTGCCCAAAAACAGAGGGTGGGTTATACCTATCGTACACCAATACCAAGGTTTCTGGCATCATGATTGGCAACTCCAAGGAGTTCTCTCATATCAAAAACATTTTCAAGCACAAGACACCGATATCCTACTTGTTACCACACCAAAATCTGGCACCACCTGGTTAAAAGCAATCTCTTT...

Protein

Download Protein FASTA

328 aa · LXL04_024108|LXL04_024108|OH1004|PROTEIN

METTQPTLPKYLQNSQVSQEFKDLTSSLPKNRGWVIPIVHQYQGFWHHDWQLQGVLSYQKHFQAQDTDILLVTTPKSGTTWLKAISFAITNRIQYHVASRDHPLIKNNPHVLVPFVEYVYADNPILDFSAIPSPRLFATHVPYVSLPDSVHNSNCKLVYMCRNPKDLFVSLFHFSNKLRPQHMGANSMEEVFELFCEGVSLYGPYWEHVLGFWNESLRRPKEVLFLKYEDMKAQPGTQVRKLAEFYGCPFTAEEEKEGIV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_024108`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_024108

Location Chr05:81250643-81251629 (+)

Description Similar to SOT12: Cytosolic sulfotransferase 12

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g03760`	Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the stereospecific sulfate conjugation of 24-epibrassinosteroids.	Molecular and biochemical characterization of two brassinosteroid sulfotransferases from Arabidopsis, AtST4a (At2g14920) and AtST1 (At2g03760).2007 · DOI: 10.1007/s00425-006-0413-y A stress-inducible sulphotransferase sulphonates salicylic acid and confers pathogen resistance in Arabidopsis.2010 · DOI: 10.1111/j.1365-3040.2010.02156.x
`At3g45070`	Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to specifically catalyze the sulfate conjugation of flavones and flavonols.	Biochemical and molecular characterization of flavonoid 7-sulfotransferase from Arabidopsis thaliana.2006 · DOI: 10.1016/j.plaphy.2006.10.004
`At2g03770`	Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor.	No verified direct reference in this release
`At5g07010`	Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to specifically catalyze the sulfate conjugation of hydroxyjasmonates, with a preference for 12- hydroxyjasmonate over 11-hydroxyjasmonate.	Biochemical and molecular characterization of a hydroxyjasmonate sulfotransferase from Arabidopsis thaliana.2003 · DOI: 10.1074/jbc.m211943200
`At3g45080`	Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024108 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009694 jasmonic acid metabolic process Biological Process

GO:0009751 response to salicylic acid Biological Process

GO:0009753 response to jasmonic acid Biological Process

GO:0009806 lignan metabolic process Biological Process

GO:0009812 flavonoid metabolic process Biological Process

GO:0016131 brassinosteroid metabolic process Biological Process

GO:0051923 sulfation Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005794 Golgi apparatus Cellular Component

KEGG gene cross-reference

ath:AT2G03760

ath:AT2G03770

ath:AT3G45070

ath:AT3G45080

ath:AT5G07010

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.851

Rank 1 · LXL04_024108 · OH-1004

Nucleus0.207

Rank 2 · LXL04_024108 · OH-1004

Endoplasmic reticulum0.051

Rank 3 · LXL04_024108 · OH-1004

Peroxisome0.040

Rank 4 · LXL04_024108 · OH-1004

Mitochondrion0.034

Rank 5 · LXL04_024108 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00685.34Sulfotransfer_166-325 aa

PF13469.13Sulfotransfer_3154-251 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_024108	`PF00685.34`	Sulfotransfer_1	66	325	1.6e-79	267.7
LXL04_024108	`PF13469.13`	Sulfotransfer_3	154	251	2e-07	32.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P52839`	Arabidopsis thaliana	Cytosolic sulfotransferase 12	50.765%	Swiss-Prot	strong database homology
`Q9M1V2`	Arabidopsis thaliana	Cytosolic sulfotransferase 5	49.844%	Swiss-Prot	moderate database homology
`Q9ZPQ5`	Arabidopsis thaliana	Cytosolic sulfotransferase 13	48.171%	Swiss-Prot	moderate database homology
`Q8L5A7`	Arabidopsis thaliana	Cytosolic sulfotransferase 15	45.062%	Swiss-Prot	moderate database homology
`Q9M1V1`	Arabidopsis thaliana	Cytosolic sulfotransferase 6	48.758%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card