LXL04_022925 | RubberDandelionOmics

Gene overview

LXL04_022925

Reference: OH-1004 Chr: Chr05 Coordinates: 13717401-13720129 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1977 bp · LXL04_022925|LXL04_022925|OH1004|cDNA

ATGAAGTCTCGTTGCTTCCTTTTGGCCTTTTTTCTCCTGGTTGCTAGTTGTGTTACAGATGTGGGTTGTGCCGTGCTACCACTCCCTTTGCCACCAACATCGCCACCTATAGTTCCAGGTACGCCTTGTCCCACCACAACTCCGCCATCACCCATCGTATTTCCGCCAGCTTATACACCTCCGCCAATTCCTAATCCACCACCGAATCCAAATCCAATCGTACCTGCTCCAGCACCGTCTAATTCACTCACCCCTTTCCC...

CDS

Download CDS FASTA

1977 bp · LXL04_022925|LXL04_022925|OH1004|CDS

ATGAAGTCTCGTTGCTTCCTTTTGGCCTTTTTTCTCCTGGTTGCTAGTTGTGTTACAGATGTGGGTTGTGCCGTGCTACCACTCCCTTTGCCACCAACATCGCCACCTATAGTTCCAGGTACGCCTTGTCCCACCACAACTCCGCCATCACCCATCGTATTTCCGCCAGCTTATACACCTCCGCCAATTCCTAATCCACCACCGAATCCAAATCCAATCGTACCTGCTCCAGCACCGTCTAATTCACTCACCCCTTTCCC...

Protein

Download Protein FASTA

658 aa · LXL04_022925|LXL04_022925|OH1004|PROTEIN

MKSRCFLLAFFLLVASCVTDVGCAVLPLPLPPTSPPIVPGTPCPTTTPPSPIVFPPAYTPPPIPNPPPNPNPIVPAPAPSNSLTPFPTFPPPVPTPPIINPPSPNTPNIGPTPGNSSNNCNNTTPPGVAPLPPVLNSPPPPVTPMLPPSPSPKTPPFPNPTPGATPPPPLTPTFPPLYPNSPNPPPPGVPSICPNTSLPPSPGYIPVNPPSPTPAPSVTPIFLPPPGVMPPPYTPNTPPSPTPAPSVTPISPPPPYTPNT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_022925`
TK1151 ID	TkA06G427540
OH-1004 ID	LXL04_022925
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	91.900
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_022925

Location Chr05:13717401-13720129 (-)

Description Protein of unknown function

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g75750`	Gibberellin-regulated protein that may function in hormonal controlled steps of development such as seed germination, flowering and seed maturation.	No verified direct reference in this release
`At5g59845`	Gibberellin-regulated protein that may function in hormonal controlled steps of development such as seed germination, flowering and seed maturation.	No verified direct reference in this release
`At5g15230`	Gibberellin-regulated protein involved in the regulation of floral meristem and floral organ identity, and promotion of seed size and weight.	GASA4, one of the 14-member Arabidopsis GASA family of small polypeptides, regulates flowering and seed development.2007 · DOI: 10.1093/pcp/pcm016 The Arabidopsis cysteine-rich protein GASA4 promotes GA responses and exhibits redox activity in bacteria and in planta.2010 · DOI: 10.1111/j.1365-313x.2010.04390.x
`At2g18420`	Gibberellin-regulated protein that may function in hormonal controlled steps of development such as seed germination, flowering and seed maturation.	No verified direct reference in this release
`At2g14900`	Gibberellin-regulated protein that may function in hormonal controlled steps of development such as seed germination, flowering and seed maturation.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022925 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009737 response to abscisic acid Biological Process

GO:0009739 response to gibberellin Biological Process

GO:0009740 gibberellic acid mediated signaling pathway Biological Process

GO:0009741 response to brassinosteroid Biological Process

GO:0009826 unidimensional cell growth Biological Process

GO:0045454 cell redox homeostasis Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0009505 plant-type cell wall Cellular Component

KEGG gene cross-reference

ath:AT1G75750

ath:AT2G14900

ath:AT2G18420

ath:AT5G15230

ath:AT5G59845

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.712

Rank 1 · LXL04_022925 · OH-1004

Endoplasmic reticulum0.102

Rank 2 · LXL04_022925 · OH-1004

Cell membrane0.085

Rank 3 · LXL04_022925 · OH-1004

Cytoplasm0.062

Rank 4 · LXL04_022925 · OH-1004

Plastid0.026

Rank 5 · LXL04_022925 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02704.20GASA598-658 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_022925	`PF02704.20`	GASA	598	658	1.9e-16	60.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P46689`	Arabidopsis thaliana	Gibberellin-regulated protein 1	50.820%	Swiss-Prot	weak database homology
`Q8LFM2`	Arabidopsis thaliana	Gibberellin-regulated protein 10	45.902%	Swiss-Prot	weak database homology
`P46690`	Arabidopsis thaliana	Gibberellin-regulated protein 4	44.828%	Swiss-Prot	weak database homology
`F4IQJ4`	Arabidopsis thaliana	Gibberellin-regulated protein 11	47.541%	Swiss-Prot	weak database homology
`O82328`	Arabidopsis thaliana	Gibberellin-regulated protein 7	49.180%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card