LXL04_021493 | RubberDandelionOmics

Gene overview

LXL04_021493

Reference: OH-1004 Chr: Chr04 Coordinates: 131142497-131144074 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

909 bp · LXL04_021493|LXL04_021493|OH1004|cDNA

ATGTTGAAATTTGCCCCTTTTAAAACCATTGCTACCATGATCTCTTCTTCATATCCTTCCTTCTCGCTGCCCCCGAAATCTTCCTTCCCTCCAATGCCGTCTCTCTCCGCCGCTACTGTTTTCCTCCGTCCTCTTTCGTCTGCCCCTATGGGTGACGATTCCGGCATGGATGCTGTCCAGCGACGCCTCATGCTCGAAGACGAGTCGGTTTTCTTTTTGCTTAATCCTGTTCCTGCCGTGATTCTAATTCTAGCTTCACT...

CDS

Download CDS FASTA

909 bp · LXL04_021493|LXL04_021493|OH1004|CDS

ATGTTGAAATTTGCCCCTTTTAAAACCATTGCTACCATGATCTCTTCTTCATATCCTTCCTTCTCGCTGCCCCCGAAATCTTCCTTCCCTCCAATGCCGTCTCTCTCCGCCGCTACTGTTTTCCTCCGTCCTCTTTCGTCTGCCCCTATGGGTGACGATTCCGGCATGGATGCTGTCCAGCGACGCCTCATGCTCGAAGACGAGTCGGTTTTCTTTTTGCTTAATCCTGTTCCTGCCGTGATTCTAATTCTAGCTTCACT...

Protein

Download Protein FASTA

302 aa · LXL04_021493|LXL04_021493|OH1004|PROTEIN

MLKFAPFKTIATMISSSYPSFSLPPKSSFPPMPSLSAATVFLRPLSSAPMGDDSGMDAVQRRLMLEDESVFFLLNPVPAVILILASLCLCILVDENDKVVGHDTKYNCHLMEKIEKGNMLHRAFSVFLFNSKYELLLQQRSATKVTFPLVWTNTCCSHPLYRDTELIDENALGVRNAAQRKLRDELGIPSEDVPVDEFTPLGRILYKAASDGKWGEHELDYVLFIVRDVNLSPNPDEVKDIKYVNPEQLRELVRKADGGE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_021493`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_021493

Location Chr04:131142497-131144074 (-)

Description Similar to IPI2: Isopentenyl-diphosphate Delta-isomerase II

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g16440`	Catalyzes the 1,3-allylic rearrangement of the homoallylic substrate isopentenyl (IPP) to its highly electrophilic allylic isomer, dimethylallyl diphosphate (DMAPP).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021493 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0008299 isoprenoid biosynthetic process Biological Process

GO:0009240 isopentenyl diphosphate biosynthetic process Biological Process

GO:0015979 photosynthesis Biological Process

GO:0015995 chlorophyll biosynthetic process Biological Process

GO:0050992 dimethylallyl diphosphate biosynthetic process Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0004452 isopentenyl-diphosphate delta-isomerase activity Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT5G16440

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.545

Rank 1 · LXL04_021493 · OH-1004

Mitochondrion0.412

Rank 2 · LXL04_021493 · OH-1004

Cytoplasm0.093

Rank 3 · LXL04_021493 · OH-1004

Nucleus0.046

Rank 4 · LXL04_021493 · OH-1004

Endoplasmic reticulum0.032

Rank 5 · LXL04_021493 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00293.35NUDIX119-257 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_021493	`PF00293.35`	NUDIX	119	257	1.1e-16	61.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q38929`	Arabidopsis thaliana	Isopentenyl-diphosphate Delta-isomerase I, chloroplastic	70.463%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card