LXL04_021193 | RubberDandelionOmics

Gene overview

LXL04_021193

Reference: OH-1004 Chr: Chr04 Coordinates: 124102937-124105636 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1284 bp · LXL04_021193|LXL04_021193|OH1004|cDNA

AtgcttttgaacttagcagattataagGGTTACGAAATTTCGATTTGGGGAGAACCAAAATTCGGAACCAGCAATAACCGGCATAAGCGATTCGTCGGAAGGGGAGCTGTCTTGAAAATTTCCCTCATCCCCGTTTTCTCCACAGCCGCACTCGACCTCCATTGGCGACCTCCGATCCACTCGAGCTTCGCAGTGACGACGACGACGAGCAGGGAAGCAGCGAAGACGACGACATTCGAATTGTCTTCTTCCTCGGAGTC...

CDS

Download CDS FASTA

1284 bp · LXL04_021193|LXL04_021193|OH1004|CDS

ATGCTTTTGAACTTAGCAGATTATAAGGGTTACGAAATTTCGATTTGGGGAGAACCAAAATTCGGAACCAGCAATAACCGGCATAAGCGATTCGTCGGAAGGGGAGCTGTCTTGAAAATTTCCCTCATCCCCGTTTTCTCCACAGCCGCACTCGACCTCCATTGGCGACCTCCGATCCACTCGAGCTTCGCAGTGACGACGACGACGAGCAGGGAAGCAGCGAAGACGACGACATTCGAATTGTCTTCTTCCTCGGAGTC...

Protein

Download Protein FASTA

427 aa · LXL04_021193|LXL04_021193|OH1004|PROTEIN

MLLNLADYKGYEISIWGEPKFGTSNNRHKRFVGRGAVLKISLIPVFSTAALDLHWRPPIHSSFAVTTTTSREAAKTTTFELSSSSESRQVSAVFFLGVATVDSPSTDSKVQSAVPFEIGSDDDDEQGSSEVATVDSPAKTTTTSRAAKTTTAIPSFRLFSFLIPWWLEFYPLLADEDKPIECTHLPGETIYVPTGWWHCVLNLETTIAVTQNYVNSKNFEFVCLDMAPGYQHKGVCRAGLLALTEGQNGNSDISELSRKE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_021193`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_021193

Location Chr04:124102937-124105636 (+)

Description Similar to At1g78280: F-box protein At1g78280

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g78280`	May function as histone H3 lysine demethylase and be involved in regulation of gene expression.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021193 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006338 chromatin remodeling Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006397 mRNA processing Biological Process

GO:0006909 phagocytosis Biological Process

GO:0008380 RNA splicing Biological Process

GO:0017185 peptidyl-lysine hydroxylation Biological Process

GO:0018395 peptidyl-lysine hydroxylation to 5-hydroxy-L-lysine Biological Process

GO:0030154 cell differentiation Biological Process

GO:0032463 negative regulation of protein homooligomerization Biological Process

GO:0035513 oxidative RNA demethylation Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0045944 positive regulation of transcription by RNA polymerase II Biological Process

KEGG gene cross-reference

ath:AT1G78280

bta:508343

dre:266962

hsa:23210

pon:100173544

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.354

Rank 1 · LXL04_021193 · OH-1004

Cytoplasm0.352

Rank 2 · LXL04_021193 · OH-1004

Cell membrane0.174

Rank 3 · LXL04_021193 · OH-1004

Endoplasmic reticulum0.143

Rank 4 · LXL04_021193 · OH-1004

Mitochondrion0.098

Rank 5 · LXL04_021193 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13621.13Cupin_8168-216 aa

PF02373.29JmjC169-212 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_021193	`PF13621.13`	Cupin_8	168	216	4.1e-07	30.9
LXL04_021193	`PF02373.29`	JmjC	169	212	5.5e-07	30.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M9E8`	Arabidopsis thaliana	Lysine-specific demethylase JMJ21	51.890%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card