LXL04_020989 | RubberDandelionOmics

Gene overview

LXL04_020989

Reference: OH-1004 Chr: Chr04 Coordinates: 117538130-117539053 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

924 bp · LXL04_020989|LXL04_020989|OH1004|cDNA

ATGAAGTTCCCATACCCCGGTGCCCTAACCGCTTTACAATACTTCACCAGTGCTTCCGGTGTTCTCCTTTTCGGGTCCCTCAACTTTCTCCAACATGACCGTTTAGACCTCCAAACAATGTTCCGTTTCCTTCCAGCCGCCATCATCTTCTACCTTTCTCTTTTCACAAACAGCGAGCTCCTCCTTCACGCAAATGTCGACACCTTCATTGTCTTCAGGTCAGCAGTCCCGATATTCGTCGCCATTGGAGAAGCTCTCTA...

CDS

Download CDS FASTA

924 bp · LXL04_020989|LXL04_020989|OH1004|CDS

ATGAAGTTCCCATACCCCGGTGCCCTAACCGCTTTACAATACTTCACCAGTGCTTCCGGTGTTCTCCTTTTCGGGTCCCTCAACTTTCTCCAACATGACCGTTTAGACCTCCAAACAATGTTCCGTTTCCTTCCAGCCGCCATCATCTTCTACCTTTCTCTTTTCACAAACAGCGAGCTCCTCCTTCACGCAAATGTCGACACCTTCATTGTCTTCAGGTCAGCAGTCCCGATATTCGTCGCCATTGGAGAAGCTCTCTA...

Protein

Download Protein FASTA

307 aa · LXL04_020989|LXL04_020989|OH1004|PROTEIN

MKFPYPGALTALQYFTSASGVLLFGSLNFLQHDRLDLQTMFRFLPAAIIFYLSLFTNSELLLHANVDTFIVFRSAVPIFVAIGEALYLHQPWPSLKTWLSLATIFAGSVLYVITDYQFTLMAYSWALAYLISMSIDFVYIKHVVMTIGLNTWGLVLYNNLEALLLFPLELLVMGELKKIKHEIKEESDWYSFEVVLPVGLSCLFGLAISFFGFSCRRAISATGFTVLGIVNKLLTVVINLMIWDKHSTVVGTVGLLICMF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_020989`
TK1151 ID	TkA01G434820
OH-1004 ID	LXL04_020989
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	54.600
Protein coverage (%)	TK1151 78.824 / OH-1004 86.971 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_020989

Location Chr04:117538130-117539053 (-)

Description Similar to GONST3: GDP-mannose transporter GONST3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g76340`	GDP-mannose transporter that may be involved in the import of GDP-mannose from the cytoplasm into the Golgi lumen.	Arabidopsis thaliana expresses multiple Golgi-localised nucleotide-sugar transporters related to GONST1.2004 · DOI: 10.1007/s00438-004-1071-z
`At5g19980`	Acts as the major nucleotide-sugar transporter for the import of GDP-Fucose into the Golgi lumen.	Arabidopsis thaliana expresses multiple Golgi-localised nucleotide-sugar transporters related to GONST1.2004 · DOI: 10.1007/s00438-004-1071-z The Arabidopsis Golgi-localized GDP-L-fucose transporter is required for plant development.2016 · DOI: 10.1038/ncomms12119
`At4g31600`	Nucleotide-sugar transporter that transports UDP-glucose and UDP-galactose.	Arabidopsis thaliana AtUTr7 encodes a golgi-localized UDP-glucose/UDP-galactose transporter that affects lateral root emergence.2012 · DOI: 10.1093/mp/sss074
`At2g13650`	Involved in the import of GDP-mannose from the cytoplasm into the Golgi lumen.	Identification and characterization of GONST1, a golgi-localized GDP-mannose transporter in Arabidopsis.2001 · DOI: 10.1105/tpc.010247 Abnormal glycosphingolipid mannosylation triggers salicylic acid-mediated responses in Arabidopsis.2013 · DOI: 10.1105/tpc.113.111500
`At5g17630`	Sugar phosphate/phosphate translocator that transports inorganic phosphate, triose phosphate, 3-phosphoglycerate, xylulose 5-phosphate (Xul-5-P) and to a lesser extent ribulose 5-phosphate.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_020989 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0015713 phosphoglycerate transmembrane transport Biological Process

GO:0015780 nucleotide-sugar transmembrane transport Biological Process

GO:0015783 GDP-fucose transmembrane transport Biological Process

GO:0015786 UDP-glucose transmembrane transport Biological Process

GO:0035436 triose phosphate transmembrane transport Biological Process

GO:0048527 lateral root development Biological Process

GO:0055085 transmembrane transport Biological Process

GO:0072334 UDP-galactose transmembrane transport Biological Process

GO:0080147 root hair cell development Biological Process

GO:1990570 GDP-mannose transmembrane transport Biological Process

GO:0000138 Golgi trans cisterna Cellular Component

KEGG gene cross-reference

ath:AT1G76340

ath:AT2G13650

ath:AT4G31600

ath:AT5G17630

ath:AT5G19980

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.708

Rank 1 · LXL04_020989 · OH-1004

Endoplasmic reticulum0.234

Rank 2 · LXL04_020989 · OH-1004

Cytoplasm0.116

Rank 3 · LXL04_020989 · OH-1004

Cell membrane0.042

Rank 4 · LXL04_020989 · OH-1004

Lysosome / Vacuole0.032

Rank 5 · LXL04_020989 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03151.23TPT3-265 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_020989	`PF03151.23`	TPT	3	265	1.1e-14	55.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9S845`	Arabidopsis thaliana	GDP-mannose transporter GONST3	82.237%	Swiss-Prot	strong database homology
`Q84L08`	Arabidopsis thaliana	GDP-fucose transporter 1	51.000%	Swiss-Prot	strong database homology
`Q94B65`	Arabidopsis thaliana	UDP-galactose/UDP-glucose transporter 7	22.680%	Swiss-Prot	weak database homology
`Q941R4`	Arabidopsis thaliana	GDP-mannose transporter GONST1	23.507%	Swiss-Prot	weak database homology
`Q9LF61`	Arabidopsis thaliana	Xylulose 5-phosphate/phosphate translocator, chloroplastic	23.656%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card