LXL04_019896 | RubberDandelionOmics

Gene overview

LXL04_019896

Reference: OH-1004 Chr: Chr04 Coordinates: 43569620-43570979 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

573 bp · LXL04_019896|LXL04_019896|OH1004|cDNA

ATGACGAGAATGGTGAGGAATTGCATCCAATCGATGCTGAAACTAGTAAATTCGTTCACCGGAATGTTTGGTATCGCGATGATCATCTACGGGTTGTGGATGATTAGGGCTTGGCAGCGCCAAATGGACGACTCCGATTACTCTACTCCATGGTTCATATACACTATCCTTGGACTTGGTGCAACCATTTGTGTCATCACATGCTCCGGTCATATCGCTGCAGAGACCGCAAATGGATCCTGCCTCTATTGTTATTTGGT...

CDS

Download CDS FASTA

573 bp · LXL04_019896|LXL04_019896|OH1004|CDS

ATGACGAGAATGGTGAGGAATTGCATCCAATCGATGCTGAAACTAGTAAATTCGTTCACCGGAATGTTTGGTATCGCGATGATCATCTACGGGTTGTGGATGATTAGGGCTTGGCAGCGCCAAATGGACGACTCCGATTACTCTACTCCATGGTTCATATACACTATCCTTGGACTTGGTGCAACCATTTGTGTCATCACATGCTCCGGTCATATCGCTGCAGAGACCGCAAATGGATCCTGCCTCTATTGTTATTTGGT...

Protein

Download Protein FASTA

190 aa · LXL04_019896|LXL04_019896|OH1004|PROTEIN

MTRMVRNCIQSMLKLVNSFTGMFGIAMIIYGLWMIRAWQRQMDDSDYSTPWFIYTILGLGATICVITCSGHIAAETANGSCLYCYLVFVFMLLMVEGAVITDVFLNRNWEKDFPEDRSGNFHEFRDFIKENFDVCKWVGFSIIAVQGLSLILALILKAVGPYREIEYDSDDYVTIEDHPLLTNYVNQPRY

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_019896`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_019896

Location Chr04:43569620-43570979 (-)

Description Similar to TOM2AH3: Tetraspanin-19

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g20740`	May be involved in the regulation of cell differentiation.	No verified direct reference in this release
`At2g20230`	May be involved in the regulation of cell differentiation.	No verified direct reference in this release
`At4g28770`	May be involved in the regulation of cell differentiation.	No verified direct reference in this release
`At1g32400`	Necessary for the efficient intracellular multiplication of tobamoviruses, being a component of the replication complex.	Arabidopsis TOBAMOVIRUS MULTIPLICATION (TOM) 2 locus encodes a transmembrane protein that interacts with TOM1.2003 · DOI: 10.1093/emboj/cdg034 Analysis of tobamovirus multiplication in Arabidopsis thaliana mutants defective in TOM2A homologues.2008 · DOI: 10.1099/vir.0.2008/000539-0

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019896 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000325 plant-type vacuole Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005774 vacuolar membrane Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009705 plant-type vacuole membrane Cellular Component

GO:0016020 membrane Cellular Component

KEGG gene cross-reference

ath:AT1G32400

ath:AT2G20230

ath:AT2G20740

ath:AT4G28770

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.420

Rank 1 · LXL04_019896 · OH-1004

Cell membrane0.308

Rank 2 · LXL04_019896 · OH-1004

Cytoplasm0.296

Rank 3 · LXL04_019896 · OH-1004

Golgi apparatus0.125

Rank 4 · LXL04_019896 · OH-1004

Endoplasmic reticulum0.097

Rank 5 · LXL04_019896 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00335.27Tetraspanin12-109 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_019896	`PF00335.27`	Tetraspanin	12	109	6.8e-13	49.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q940P5`	Arabidopsis thaliana	Tetraspanin-19	57.949%	Swiss-Prot	strong database homology
`Q93XY5`	Arabidopsis thaliana	Tetraspanin-18	31.884%	Swiss-Prot	moderate database homology
`Q9SVU4`	Arabidopsis thaliana	Tetraspanin-20	43.651%	Swiss-Prot	moderate database homology
`Q9C5W7`	Arabidopsis thaliana	Tobamovirus multiplication protein 2A	26.291%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card