LXL04_019865 | RubberDandelionOmics

Gene overview

LXL04_019865

Reference: OH-1004 Chr: Chr04 Coordinates: 42410552-42411454 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

825 bp · LXL04_019865|LXL04_019865|OH1004|cDNA

ATGAATGATTTGTTCTCCCAATCGTTTAAGCAATACCAAGATAAAGATGTCGACTTGGAGGCTGGTGGTGGCGCCGGGGGTAGCTCCGACGAACTTGACAATTTCTTTGAAGATGTCGAGAAGGTCAAGGAAGACATGGCGGGGATAGAGAAACTCTACAAAAGCCTTCAAGAGGGCAACGAGGAAAGCAAAAATGCCAGCAATGCAAACGCCATGAAACAAATCCGAGCAAAAATGGACTCCGATGTTTCACAGGTGTT...

CDS

Download CDS FASTA

825 bp · LXL04_019865|LXL04_019865|OH1004|CDS

ATGAATGATTTGTTCTCCCAATCGTTTAAGCAATACCAAGATAAAGATGTCGACTTGGAGGCTGGTGGTGGCGCCGGGGGTAGCTCCGACGAACTTGACAATTTCTTTGAAGATGTCGAGAAGGTCAAGGAAGACATGGCGGGGATAGAGAAACTCTACAAAAGCCTTCAAGAGGGCAACGAGGAAAGCAAAAATGCCAGCAATGCAAACGCCATGAAACAAATCCGAGCAAAAATGGACTCCGATGTTTCACAGGTGTT...

Protein

Download Protein FASTA

274 aa · LXL04_019865|LXL04_019865|OH1004|PROTEIN

MNDLFSQSFKQYQDKDVDLEAGGGAGGSSDELDNFFEDVEKVKEDMAGIEKLYKSLQEGNEESKNASNANAMKQIRAKMDSDVSQVLKRVRVIKGKIEALDKANAANRKLPGCGPGSSSDRTRTAVVSGLGKKLKSMMDDFQSLRTRMNDEYKETVGRRYFTITGQKANDELIENLISSGEGEDFMQKAIQDQGRGQIMDTISEIQERHDSVKEIEKNLMELHQIFLDMAALVESQGQQLNDIESHVNHASSFVHRGTEQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_019865`
TK1151 ID	TkA05G096820
OH-1004 ID	LXL04_019865
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	89.500
Protein coverage (%)	TK1151 88.412 / OH-1004 83.212 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_019865

Location Chr04:42410552-42411454 (+)

Description Similar to SYP124: Syntaxin-124

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g61290`	Vesicle trafficking protein that functions in the secretory pathway.	No verified direct reference in this release
`At1g11250`	Vesicle trafficking protein that functions in the secretory pathway.	No verified direct reference in this release
`At4g03330`	Vesicle trafficking protein that functions in the secretory pathway (Probable).	Syntaxin of plant proteins SYP123 and SYP132 mediate root hair tip growth in Arabidopsis thaliana.2014 · DOI: 10.1093/pcp/pcu048
`At3g11820`	Vesicle trafficking protein that functions in the secretory pathway (By similarity).	Arabidopsis SNAREs SYP61 and SYP121 coordinate the trafficking of plasma membrane aquaporin PIP2;7 to modulate the cell membrane water permeability.2014 · DOI: 10.1105/tpc.114.127159
`At3g52400`	Vesicle trafficking protein that functions in the secretory pathway.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019865 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006612 protein targeting to membrane Biological Process

GO:0006886 intracellular protein transport Biological Process

GO:0006887 exocytosis Biological Process

GO:0006906 vesicle fusion Biological Process

GO:0006952 defense response Biological Process

GO:0009620 response to fungus Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009860 pollen tube growth Biological Process

GO:0010119 regulation of stomatal movement Biological Process

GO:0010148 transpiration Biological Process

GO:0016192 vesicle-mediated transport Biological Process

GO:0031348 negative regulation of defense response Biological Process

KEGG gene cross-reference

ath:AT1G11250

ath:AT1G61290

ath:AT3G11820

ath:AT3G52400

ath:AT4G03330

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.445

Rank 1 · LXL04_019865 · OH-1004

Cell membrane0.362

Rank 2 · LXL04_019865 · OH-1004

Lysosome / Vacuole0.142

Rank 3 · LXL04_019865 · OH-1004

Golgi apparatus0.138

Rank 4 · LXL04_019865 · OH-1004

Nucleus0.122

Rank 5 · LXL04_019865 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00804.32Syntaxin30-190 aa

PF05739.27SNARE204-274 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_019865	`PF00804.32`	Syntaxin	30	190	7.9e-51	172.7
LXL04_019865	`PF05739.27`	SNARE	204	274	5.4e-23	81.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O64791`	Arabidopsis thaliana	Syntaxin-124	70.251%	Swiss-Prot	strong database homology
`Q9SXB0`	Arabidopsis thaliana	Syntaxin-125	70.073%	Swiss-Prot	strong database homology
`Q9ZQZ8`	Arabidopsis thaliana	Syntaxin-123	62.937%	Swiss-Prot	strong database homology
`Q9ZSD4`	Arabidopsis thaliana	Syntaxin-121	59.696%	Swiss-Prot	strong database homology
`Q9SVC2`	Arabidopsis thaliana	Syntaxin-122	53.684%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card