LXL04_019772 | RubberDandelionOmics

Gene overview

LXL04_019772

Reference: OH-1004 Chr: Chr04 Coordinates: 39795570-39796316 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

747 bp · LXL04_019772|LXL04_019772|OH1004|cDNA

ATGAAGATCCAAATTTTAACGCAAGCATACGCATTGACCATCGAAGTTGGTATGCAAGAAACCATTCTCGAAATTAAGAGGAAAATTGAACATTTTCTTGGTGTTCCTATATCTTCACAAACTCTTAGTGTGTGTGATTGGGAATTACTCGACGGGCTTGACCTAGAGGACTACCCAATCGTTAATGAAGGTACAAAAATTGATCTCACGATCAATCATACACTATCTTTAGAGAACCATAGACAAATCCAGATTATCGT...

CDS

Download CDS FASTA

747 bp · LXL04_019772|LXL04_019772|OH1004|CDS

ATGAAGATCCAAATTTTAACGCAAGCATACGCATTGACCATCGAAGTTGGTATGCAAGAAACCATTCTCGAAATTAAGAGGAAAATTGAACATTTTCTTGGTGTTCCTATATCTTCACAAACTCTTAGTGTGTGTGATTGGGAATTACTCGACGGGCTTGACCTAGAGGACTACCCAATCGTTAATGAAGGTACAAAAATTGATCTCACGATCAATCATACACTATCTTTAGAGAACCATAGACAAATCCAGATTATCGT...

Protein

Download Protein FASTA

248 aa · LXL04_019772|LXL04_019772|OH1004|PROTEIN

MKIQILTQAYALTIEVGMQETILEIKRKIEHFLGVPISSQTLSVCDWELLDGLDLEDYPIVNEGTKIDLTINHTLSLENHRQIQIIVKFSSRKHNIEVDRTETVGSLKEKIHIIDGTPIKQMTLFFSGVEMEEDFRNLSDYGVGELSEIIVFLKTMSRLVSQPPSRKLGFVVQTSSALLNSTCIPLEMKDSSTVNELRELLLTRKFLPRDDYIFIHKQRIMRENCSLRWHGVENGDYLYVFKGTVSRA

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_019772`
TK1151 ID	TkA05G085810
OH-1004 ID	LXL04_019772
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	74.200
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_019772`
Location	Chr04:39795570-39796316 (-)
Description	Similar to ubi: Polyubiquitin (Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_019772` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0000902 cell morphogenesis Biological Process GO:0007346 regulation of mitotic cell cycle Biological Process GO:0009306 protein secretion Biological Process GO:0016567 protein ubiquitination Biological Process GO:0019941 modification-dependent protein catabolic process Biological Process GO:0030447 filamentous growth Biological Process GO:0033554 cellular response to stress Biological Process GO:0034605 cellular response to heat Biological Process GO:0036166 phenotypic switching Biological Process GO:0044182 filamentous growth of a population of unicellular organisms Biological Process GO:0070726 cell wall assembly Biological Process GO:0005634 nucleus Cellular Component
KEGG gene cross-reference	cal:CAALFM_C307270CA ncr:NCU05995 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.513

Rank 1 · LXL04_019772 · OH-1004

Nucleus0.483

Rank 2 · LXL04_019772 · OH-1004

Cell membrane0.061

Rank 3 · LXL04_019772 · OH-1004

Endoplasmic reticulum0.046

Rank 4 · LXL04_019772 · OH-1004

Mitochondrion0.040

Rank 5 · LXL04_019772 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00240.30ubiquitin12-71 aa

PF11976.15Rad60-SLD83-146 aa

PF00240.30ubiquitin85-154 aa

PF14560.13Ubiquitin_294-151 aa

PF00240.30ubiquitin179-240 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_019772	`PF00240.30`	ubiquitin	12	71	1.7e-30	105.3
LXL04_019772	`PF11976.15`	Rad60-SLD	83	146	9.8e-07	29.2
LXL04_019772	`PF00240.30`	ubiquitin	85	154	1.7e-30	105.3
LXL04_019772	`PF14560.13`	Ubiquitin_2	94	151	4.4e-10	40.6
LXL04_019772	`PF00240.30`	ubiquitin	179	240	1.7e-30	105.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card