LXL04_019567 | RubberDandelionOmics

Gene overview

LXL04_019567

Reference: OH-1004 Chr: Chr04 Coordinates: 34096067-34097188 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1122 bp · LXL04_019567|LXL04_019567|OH1004|cDNA

ATGGCGATTTGTCATCATCATCAACCTTCATTCACCATCCCTTCTTCTTTCCCATTTACTACTAATCTTACAAACAAATCCCAACTTCATCTCTCATCGTCTTTCCGTTGCAATCTATCCCTCACTTCAACTCTTGAACCTGAACCCGTCTACACCGCCGTCAAGTCCTTCGCCCCCGCCACCGTAGCAAATCTTGGCCCTGGCTTTGACTTTCTCGGCTGTGCAGTCGACGGGATCGGAGACTATGTCACCCTCAAAAT...

CDS

Download CDS FASTA

1122 bp · LXL04_019567|LXL04_019567|OH1004|CDS

ATGGCGATTTGTCATCATCATCAACCTTCATTCACCATCCCTTCTTCTTTCCCATTTACTACTAATCTTACAAACAAATCCCAACTTCATCTCTCATCGTCTTTCCGTTGCAATCTATCCCTCACTTCAACTCTTGAACCTGAACCCGTCTACACCGCCGTCAAGTCCTTCGCCCCCGCCACCGTAGCAAATCTTGGCCCTGGCTTTGACTTTCTCGGCTGTGCAGTCGACGGGATCGGAGACTATGTCACCCTCAAAAT...

Protein

Download Protein FASTA

373 aa · LXL04_019567|LXL04_019567|OH1004|PROTEIN

MAICHHHQPSFTIPSSFPFTTNLTNKSQLHLSSSFRCNLSLTSTLEPEPVYTAVKSFAPATVANLGPGFDFLGCAVDGIGDYVTLKIDPQVHPGEVSISEITGTGNSANKLSKNPIWNCAGIAAISVMKMLNIRSVGLSLSLEKGLPLGSGLGSSAASAAAAAIAVNELFGGKLPALDLVLAGLESEAKVSGYHADNIAPAIMGGFVLVRSYDPLELIPLQFPADKNLYFVLVNPEFEAPTKKMRAALPKEITMSHHVWN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_019567`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_019567

Location Chr04:34096067-34097188 (-)

Description Similar to HSK: Homoserine kinase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g17265`	Catalyzes the ATP-dependent phosphorylation of L-homoserine to L-homoserine phosphate.	Identification of arabidopsis loci required for susceptibility to the downy mildew pathogen Hyaloperonospora parasitica.2005 · DOI: 10.1094/mpmi-18-0583 Downy mildew resistance in Arabidopsis by mutation of HOMOSERINE KINASE.2009 · DOI: 10.1105/tpc.109.066811

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019567 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0009086 methionine biosynthetic process Biological Process

GO:0009088 L-threonine biosynthetic process Biological Process

GO:0009617 response to bacterium Biological Process

GO:0009620 response to fungus Biological Process

GO:0048573 photoperiodism, flowering Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0004413 homoserine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

KEGG gene cross-reference

ath:AT2G17265

cph:Cpha266_2545

cte:CT2034

cts:Ctha_0872

pvi:Cvib_1629

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.959

Rank 1 · LXL04_019567 · OH-1004

Mitochondrion0.066

Rank 2 · LXL04_019567 · OH-1004

Cytoplasm0.027

Rank 3 · LXL04_019567 · OH-1004

Peroxisome0.019

Rank 4 · LXL04_019567 · OH-1004

Nucleus0.017

Rank 5 · LXL04_019567 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00288.33GHMP_kinases_N129-205 aa

PF08544.19GHMP_kinases_C268-344 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_019567	`PF00288.33`	GHMP_kinases_N	129	205	1.2e-15	58.1
LXL04_019567	`PF08544.19`	GHMP_kinases_C	268	344	3.2e-14	53.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8L7R2`	Arabidopsis thaliana	Homoserine kinase	77.259%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card