LXL04_019540 | RubberDandelionOmics

Gene overview

LXL04_019540

Reference: OH-1004 Chr: Chr04 Coordinates: 33370550-33374507 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1767 bp · LXL04_019540|LXL04_019540|OH1004|cDNA

ATGATGCTTCCCGCCACAGCCttttcatcatcttcatcttcatcagcTAATTCAGCTGTTGTTCGAGTGGATAAAGCCACAAGCGAATTCTTGAACGGCCCTGATTGGACTCTTAACATCGATATTTGCGACACCATCAACGCGAATCATTGGCTTGCAAAAGATGTTGTTAAGGCTTTAAAGAAAAGGTTACAACACAAGAACCCTCATGTTCAACTGCTTTGCTTGACGCTTTTAGAAACAATGGTAAAGAATTGTGG...

CDS

Download CDS FASTA

1767 bp · LXL04_019540|LXL04_019540|OH1004|CDS

ATGATGCTTCCCGCCACAGCCTTTTCATCATCTTCATCTTCATCAGCTAATTCAGCTGTTGTTCGAGTGGATAAAGCCACAAGCGAATTCTTGAACGGCCCTGATTGGACTCTTAACATCGATATTTGCGACACCATCAACGCGAATCATTGGCTTGCAAAAGATGTTGTTAAGGCTTTAAAGAAAAGGTTACAACACAAGAACCCTCATGTTCAACTGCTTTGCTTGACGCTTTTAGAAACAATGGTAAAGAATTGTGG...

Protein

Download Protein FASTA

588 aa · LXL04_019540|LXL04_019540|OH1004|PROTEIN

MMLPATAFSSSSSSSANSAVVRVDKATSEFLNGPDWTLNIDICDTINANHWLAKDVVKALKKRLQHKNPHVQLLCLTLLETMVKNCGDNVHHQIAERNILPEMIKIVKKKTDMRVREKILVLLDSWQEAFGGRGGKYPQYYFAYDELRQSGVQFPHRSPDAAPIFTPPVTHPSFGPPQPNYGMPSNSSTRLDEAMASEIENLSLSVIESMRNVSDLLSEMLQEVDPNDRAAVKDEVIVDVVDRCRSNQKKLMQMLASTSD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_019540`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_019540

Location Chr04:33370550-33374507 (+)

Description Similar to TOL6: TOM1-like protein 6

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g38410`	Acts as a gatekeeper for degradative protein sorting to the vacuole.	No verified direct reference in this release
`At5g01760`	Might contribute to the loading of the ESCRT machinery.	No verified direct reference in this release
`At4g32760`	Might contribute to the loading of the ESCRT machinery.	No verified direct reference in this release
`At1g76970`	Might contribute to the loading of the ESCRT machinery.	No verified direct reference in this release
`At3g08790`	Might contribute to the loading of the ESCRT machinery.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019540 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0043328 protein transport to vacuole involved in ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005769 early endosome Cellular Component

GO:0005771 multivesicular body Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0031901 early endosome membrane Cellular Component

GO:0035091 phosphatidylinositol binding Molecular Function

GO:0043130 ubiquitin binding Molecular Function

KEGG gene cross-reference

ath:AT1G76970

ath:AT2G38410

ath:AT4G32760

ath:AT5G01760

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.594

Rank 1 · LXL04_019540 · OH-1004

Golgi apparatus0.311

Rank 2 · LXL04_019540 · OH-1004

Nucleus0.146

Rank 3 · LXL04_019540 · OH-1004

Cell membrane0.134

Rank 4 · LXL04_019540 · OH-1004

Lysosome / Vacuole0.105

Rank 5 · LXL04_019540 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00790.26VHS18-132 aa

PF03127.20GAT214-287 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_019540	`PF00790.26`	VHS	18	132	4.3e-35	121.3
LXL04_019540	`PF03127.20`	GAT	214	287	1.1e-19	71.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O80910`	Arabidopsis thaliana	TOM1-like protein 6	55.532%	Swiss-Prot	strong database homology
`F4KAU9`	Arabidopsis thaliana	TOM1-like protein 7	43.290%	Swiss-Prot	moderate database homology
`Q8L860`	Arabidopsis thaliana	TOM1-like protein 9	50.558%	Swiss-Prot	weak database homology
`Q6NQK0`	Arabidopsis thaliana	TOM1-like protein 4	47.569%	Swiss-Prot	weak database homology
`Q9C9Y1`	Arabidopsis thaliana	TOM1-like protein 8	44.815%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card