LXL04_019141 | RubberDandelionOmics

Gene overview

LXL04_019141

Reference: OH-1004 Chr: Chr04 Coordinates: 24508843-24512106 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1179 bp · LXL04_019141|LXL04_019141|OH1004|cDNA

ATGTCAGACGATGAAAGAGGGGAGGAAAAGGAGCTGGATCTTTCCTCTCCAGAAGTTGTAACTAAATACAAATCGGCAGCTGAGATTGTTAACAAGGCCTTGCAGTTGGTGTTATCAGAATGCAAACCAAAAGCCAAGATTGTTGATATTTGTGAGAAAGGAGATTCGTATATCAGAGAGCAAACGGGAAATATGTACAAAAATGTAAAAAAGAAGATTGAAAGAGGTGTTGCATTTCCCACATGTTTGTCAGTGAACAA...

CDS

Download CDS FASTA

1179 bp · LXL04_019141|LXL04_019141|OH1004|CDS

ATGTCAGACGATGAAAGAGGGGAGGAAAAGGAGCTGGATCTTTCCTCTCCAGAAGTTGTAACTAAATACAAATCGGCAGCTGAGATTGTTAACAAGGCCTTGCAGTTGGTGTTATCAGAATGCAAACCAAAAGCCAAGATTGTTGATATTTGTGAGAAAGGAGATTCGTATATCAGAGAGCAAACGGGAAATATGTACAAAAATGTAAAAAAGAAGATTGAAAGAGGTGTTGCATTTCCCACATGTTTGTCAGTGAACAA...

Protein

Download Protein FASTA

392 aa · LXL04_019141|LXL04_019141|OH1004|PROTEIN

MSDDERGEEKELDLSSPEVVTKYKSAAEIVNKALQLVLSECKPKAKIVDICEKGDSYIREQTGNMYKNVKKKIERGVAFPTCLSVNNTVCHYSPLASDETVLEDGDILKIDMGCHIDGFIAVVAHTHVLQQGPVTGRVADAIAAANTAAEVALRLVKPGKKNQDVTEAIQKVAAAYDCKIVEGVLSHQLKQFVIDGNKVVLSVSNPETRVDDAEFEENEVYAIDIVTSTGDGKPKLLDEKQTTIYKRAVDKSYHLKMKAS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_019141`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_019141

Location Chr04:24508843-24512106 (-)

Description Similar to EBP1: ERBB-3 BINDING PROTEIN 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g51800`	Binds RNA.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019141 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0001558 regulation of cell growth Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006364 rRNA processing Biological Process

GO:0006417 regulation of translation Biological Process

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0044843 cell cycle G1/S phase transition Biological Process

GO:0045597 positive regulation of cell differentiation Biological Process

GO:0045892 negative regulation of DNA-templated transcription Biological Process

GO:0051302 regulation of cell division Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005730 nucleolus Cellular Component

KEGG gene cross-reference

ath:AT3G51800

hsa:5036

mmu:18813

rno:288778

sot:102577813

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.706

Rank 1 · LXL04_019141 · OH-1004

Nucleus0.330

Rank 2 · LXL04_019141 · OH-1004

Cell membrane0.100

Rank 3 · LXL04_019141 · OH-1004

Endoplasmic reticulum0.053

Rank 4 · LXL04_019141 · OH-1004

Mitochondrion0.052

Rank 5 · LXL04_019141 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00557.30Peptidase_M2422-224 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_019141	`PF00557.30`	Peptidase_M24	22	224	2.6e-22	80.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q96327`	Arabidopsis thaliana	ERBB-3 BINDING PROTEIN 1	83.898%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card