Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1296 bp · LXL04_019088|LXL04_019088|OH1004|cDNA
ATGGAACCTCCTTCTGCAAGTAATTTATCTTCTAGTAACAGTAGGGGCGGTTTAAGGTTCCGATTACGCGAAATCATTCGGGCGCCACTTTTGTCCTTTTTGGAGCAATCGGGAGTTTTCCACAACCAATCACGATCAGTTTCTACTTCTGATCTCGAGATGCAGCATGATCATGCAAATGATGATGAGTTCGAAGGCGGTGCCGGTGGTGTAGTCAATGGAGGGGAGGAGGTTTCTATCAGGATTTTGGGTGCGGTGGA...
1296 bp · LXL04_019088|LXL04_019088|OH1004|CDS
ATGGAACCTCCTTCTGCAAGTAATTTATCTTCTAGTAACAGTAGGGGCGGTTTAAGGTTCCGATTACGCGAAATCATTCGGGCGCCACTTTTGTCCTTTTTGGAGCAATCGGGAGTTTTCCACAACCAATCACGATCAGTTTCTACTTCTGATCTCGAGATGCAGCATGATCATGCAAATGATGATGAGTTCGAAGGCGGTGCCGGTGGTGTAGTCAATGGAGGGGAGGAGGTTTCTATCAGGATTTTGGGTGCGGTGGA...
Protein
Download Protein FASTA431 aa · LXL04_019088|LXL04_019088|OH1004|PROTEIN
MEPPSASNLSSSNSRGGLRFRLREIIRAPLLSFLEQSGVFHNQSRSVSTSDLEMQHDHANDDEFEGGAGGVVNGGEEVSIRILGAVEEELPLNAVADGGVIGNGEVQIGNERGVEELRSGVGGTEAGQQTPATSSNNNRYDIQNVAQWIEQILPFSLLLLVVLIRQHLQGFFGTIWISAVLFKSNDILQKQTALKGERKLFVLISITVIFILHIVFVYWWYQNDDLMYPLILLPPKSVPPFWHALFIILVNDSMARQAAM...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_019088 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_019088 |
|---|---|
| Location | Chr04:23567594-23569515 (-) |
| Description | Similar to RNFT2: RING finger and transmembrane domain-containing protein 2 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0016567 protein ubiquitination Biological Process GO:0051865 protein autoubiquitination Biological Process GO:1904294 positive regulation of ERAD pathway Biological Process GO:0005783 endoplasmic reticulum Cellular Component GO:0005789 endoplasmic reticulum membrane Cellular Component GO:0016020 membrane Cellular Component GO:0008270 zinc ion binding Molecular Function GO:0043130 ubiquitin binding Molecular Function GO:0061630 ubiquitin protein ligase activity Molecular Function |
| KEGG gene cross-reference | hsa:51136 hsa:84900 mmu:269695 pon:100174460 xla:414607 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF13920.13zf-C3HC4_3368-411 aaPF12678.14zf-rbx1368-408 aaPF13639.13zf-RING_2369-408 aaPF00097.32zf-C3HC4370-407 aaPF13923.13zf-C3HC4_2370-407 aaPF13445.13zf-RING_UBOX370-405 aaPF14634.13zf-RING_5370-408 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_019088 | PF13920.13 | zf-C3HC4_3 | 368 | 411 | 3.5e-10 | 40.3 |
| LXL04_019088 | PF12678.14 | zf-rbx1 | 368 | 408 | 1.3e-06 | 29.2 |
| LXL04_019088 | PF13639.13 | zf-RING_2 | 369 | 408 | 8.1e-11 | 42.7 |
| LXL04_019088 | PF00097.32 | zf-C3HC4 | 370 | 407 | 3.1e-09 | 37.3 |
| LXL04_019088 | PF13923.13 | zf-C3HC4_2 | 370 | 407 | 4.6e-09 | 36.7 |
| LXL04_019088 | PF13445.13 | zf-RING_UBOX | 370 | 405 | 8.2e-08 | 32.8 |
| LXL04_019088 | PF14634.13 | zf-RING_5 | 370 | 408 | 1.1e-07 | 32.4 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.