LXL04_018793 | RubberDandelionOmics

Gene overview

LXL04_018793

Reference: OH-1004 Chr: Chr04 Coordinates: 18316121-18319078 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1707 bp · LXL04_018793|LXL04_018793|OH1004|cDNA

ATGGCATTCTATTCAGCAATTTCTCTGGTGTTCTTGGCCTCATTTCTAGCAATACTAGTAGTGGGATCTAATGCTGGTGGGATTTCCATTTATTGGGGCCAAAATGGAAATGAAGGAACCCTAGCCGAAACTTGTAGCACAAATAACTACAAATACGTAAACATAGCCTTTCTTTGGACTTTTGGCAATGGGCGTACACCACGCATGGACTTAGCTGGCAATTGTGACCCATACAGCAATGGTTGCACCAAATTAAGCTC...

CDS

Download CDS FASTA

1707 bp · LXL04_018793|LXL04_018793|OH1004|CDS

ATGGCATTCTATTCAGCAATTTCTCTGGTGTTCTTGGCCTCATTTCTAGCAATACTAGTAGTGGGATCTAATGCTGGTGGGATTTCCATTTATTGGGGCCAAAATGGAAATGAAGGAACCCTAGCCGAAACTTGTAGCACAAATAACTACAAATACGTAAACATAGCCTTTCTTTGGACTTTTGGCAATGGGCGTACACCACGCATGGACTTAGCTGGCAATTGTGACCCATACAGCAATGGTTGCACCAAATTAAGCTC...

Protein

Download Protein FASTA

568 aa · LXL04_018793|LXL04_018793|OH1004|PROTEIN

MAFYSAISLVFLASFLAILVVGSNAGGISIYWGQNGNEGTLAETCSTNNYKYVNIAFLWTFGNGRTPRMDLAGNCDPYSNGCTKLSSDIKSCQDKGIKVMLSIGGGVGSYSLSSKQDAQEIATYLWNNFLGGETSGIRPLGNASLDGIDFDIESGGSQHWDDLARYLSAYSTKSKKVYLTAAPQCPYPDAMLGGALQTGLFDYVWVQFYNNPPCQYSANITNIEDGWKQWTSDIPVSKIFLGLPAASEAAGSGFIPVNDL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_018793`
TK1151 ID	TkA08G083340
OH-1004 ID	LXL04_018793
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	88.300
Protein coverage (%)	TK1151 98.361 / OH-1004 51.585 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_018793

Location Chr04:18316121-18319078 (+)

Description Similar to CHIT3: Acidic endochitinase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g24090`	This protein functions as a defense against chitin containing fungal pathogens.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018793 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000272 polysaccharide catabolic process Biological Process

GO:0006032 chitin catabolic process Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005773 vacuole Cellular Component

GO:0003796 lysozyme activity Molecular Function

GO:0004568 chitinase activity Molecular Function

GO:0008843 endochitinase activity Molecular Function

KEGG gene cross-reference

nta:107825584

vvi:100233088

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.924

Rank 1 · LXL04_018793 · OH-1004

Cytoplasm0.036

Rank 2 · LXL04_018793 · OH-1004

Lysosome / Vacuole0.023

Rank 3 · LXL04_018793 · OH-1004

Cell membrane0.022

Rank 4 · LXL04_018793 · OH-1004

Endoplasmic reticulum0.020

Rank 5 · LXL04_018793 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00704.35Glyco_hydro_1830-248 aa

PF00704.35Glyco_hydro_18297-516 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_018793	`PF00704.35`	Glyco_hydro_18	30	248	4.6e-52	178.4
LXL04_018793	`PF00704.35`	Glyco_hydro_18	297	516	4.6e-52	178.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P19172`	Arabidopsis thaliana	Acidic endochitinase	62.731%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card