LXL04_018736 | RubberDandelionOmics

Gene overview

LXL04_018736

Reference: OH-1004 Chr: Chr04 Coordinates: 17354429-17357983 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1680 bp · LXL04_018736|LXL04_018736|OH1004|cDNA

ATGCTCGATATAGGAACAATCCGGAGCTTCGCTTGGAACCAAAGATTCATGGATTGTCATAATCTTGAGTTATCTTGCTTATACAACCTAATGGATTCAGCAAGAAGTTGGCTGCATAAATTTCAACCTAGAGAACGGTTGAGATCAAACACCAGAAGACGAGATTCAAATAGCGATGGCGAAGATTCAAATCACCCAATCATGGACGAAGAAGCCTCAAATATCACAAAACAAAAAGTCGCTGCAGCTAAACAGTACAT...

CDS

Download CDS FASTA

1680 bp · LXL04_018736|LXL04_018736|OH1004|CDS

ATGCTCGATATAGGAACAATCCGGAGCTTCGCTTGGAACCAAAGATTCATGGATTGTCATAATCTTGAGTTATCTTGCTTATACAACCTAATGGATTCAGCAAGAAGTTGGCTGCATAAATTTCAACCTAGAGAACGGTTGAGATCAAACACCAGAAGACGAGATTCAAATAGCGATGGCGAAGATTCAAATCACCCAATCATGGACGAAGAAGCCTCAAATATCACAAAACAAAAAGTCGCTGCAGCTAAACAGTACAT...

Protein

Download Protein FASTA

559 aa · LXL04_018736|LXL04_018736|OH1004|PROTEIN

MLDIGTIRSFAWNQRFMDCHNLELSCLYNLMDSARSWLHKFQPRERLRSNTRRRDSNSDGEDSNHPIMDEEASNITKQKVAAAKQYIENHYKEQMKNLQERRERRILLEQKLADGDVSEEDQNNLLRFLEKKETEYMRLQRHKMGVDDFELLTMIGKGAFGEVRICREKTTGTVYAMKKLKKSEMLRRGQVEHVKAERNLLAEVDSNCIVKLYCSFQDNEYLYLIMEYLPGGDMMTLLMRKDTLTENEAQFYVAETVLAI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_018736`
TK1151 ID	TkA08G080190
OH-1004 ID	LXL04_018736
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 94.633 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_018736`
Location	Chr04:17354429-17357983 (-)
Description	Similar to STK38L: Serine/threonine-protein kinase 38-like
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_018736` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0000077 DNA damage checkpoint signaling Biological Process GO:0006468 protein phosphorylation Biological Process GO:0006974 DNA damage response Biological Process GO:0007165 signal transduction Biological Process GO:0010507 negative regulation of autophagy Biological Process GO:0010508 positive regulation of autophagy Biological Process GO:0035556 intracellular signal transduction Biological Process GO:0036211 protein modification process Biological Process GO:0043407 negative regulation of MAP kinase activity Biological Process GO:0051012 microtubule sliding Biological Process GO:0051128 regulation of cellular component organization Biological Process GO:0099173 postsynapse organization Biological Process
KEGG gene cross-reference	dpo:4813412 hsa:11329 hsa:23012 mmu:232533 pon:100173048 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.591

Rank 1 · LXL04_018736 · OH-1004

Nucleus0.457

Rank 2 · LXL04_018736 · OH-1004

Cell membrane0.127

Rank 3 · LXL04_018736 · OH-1004

Mitochondrion0.053

Rank 4 · LXL04_018736 · OH-1004

Golgi apparatus0.038

Rank 5 · LXL04_018736 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069.32Pkinase150-301 aa

PF07714.24PK_Tyr_Ser-Thr150-297 aa

PF03109.23ABC1223-299 aa

PF00069.32Pkinase344-447 aa

PF07714.24PK_Tyr_Ser-Thr350-412 aa

PF00433.30Pkinase_C466-510 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_018736	`PF00069.32`	Pkinase	150	301	3.3e-64	217.5
LXL04_018736	`PF07714.24`	PK_Tyr_Ser-Thr	150	297	1.1e-29	104.2
LXL04_018736	`PF03109.23`	ABC1	223	299	2e-06	27.9
LXL04_018736	`PF00069.32`	Pkinase	344	447	3.3e-64	217.5
LXL04_018736	`PF07714.24`	PK_Tyr_Ser-Thr	350	412	1.1e-29	104.2
LXL04_018736	`PF00433.30`	Pkinase_C	466	510	3.7e-09	37.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card