LXL04_018501 | RubberDandelionOmics

Gene overview

LXL04_018501

Reference: OH-1004 Chr: Chr04 Coordinates: 13851074-13855584 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

831 bp · LXL04_018501|LXL04_018501|OH1004|cDNA

ATGCAATCCATATGTATCACCATGACAAACCCTAATCTGTTATCAGTAATTGTTGCCTTCCTTTCATTGCTTTCCTTCATCTCGATATGCAGCGTGGATGCATCGAGAAAATTGTCGGACGCAAGCCAACAATTCGGGTATATAGCAGGGTCTCCAAACGAACCGGCGAAATGGGGAAGTATGAGGCCAGATTGGAAAACCTGCGAGACCGGAAAATTGCAGTCCCCTATTAATATCGATGTCGTACAAGCAGAAATGCA...

CDS

Download CDS FASTA

831 bp · LXL04_018501|LXL04_018501|OH1004|CDS

ATGCAATCCATATGTATCACCATGACAAACCCTAATCTGTTATCAGTAATTGTTGCCTTCCTTTCATTGCTTTCCTTCATCTCGATATGCAGCGTGGATGCATCGAGAAAATTGTCGGACGCAAGCCAACAATTCGGGTATATAGCAGGGTCTCCAAACGAACCGGCGAAATGGGGAAGTATGAGGCCAGATTGGAAAACCTGCGAGACCGGAAAATTGCAGTCCCCTATTAATATCGATGTCGTACAAGCAGAAATGCA...

Protein

Download Protein FASTA

276 aa · LXL04_018501|LXL04_018501|OH1004|PROTEIN

MQSICITMTNPNLLSVIVAFLSLLSFISICSVDASRKLSDASQQFGYIAGSPNEPAKWGSMRPDWKTCETGKLQSPINIDVVQAEMQPPDLKMAYKDAPVKLVNEGFDLNVEWQGDAGGIEIGGVNYKLVHSHWHTPSEHTIDGKRFDAELHLVHSSGKEELAVMGCLYTIGQPDPLIQSVAEKMKKLSGTAKGIDAGTISASDIKCGGKKYFRYIGSLTTPPCTEGVTWTIAGDVRTISQDQFQMIRGLVEPDFQENAR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_018501`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_018501

Location Chr04:13851074-13855584 (+)

Description Similar to NEC3: Bifunctional monodehydroascorbate reductase and carbonic anhydrase nectarin-3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g20990`	Reversible hydration of carbon dioxide.	No verified direct reference in this release
`At1g08080`	Reversible hydration of carbon dioxide.	No verified direct reference in this release
`At5g04180`	Reversible hydration of carbon dioxide.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018501 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000305 response to oxygen radical Biological Process

GO:0006730 one-carbon metabolic process Biological Process

GO:0006885 regulation of pH Biological Process

GO:0010037 response to carbon dioxide Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0004089 carbonate dehydratase activity Molecular Function

GO:0008270 zinc ion binding Molecular Function

GO:0016656 monodehydroascorbate reductase (NADH) activity Molecular Function

KEGG gene cross-reference

ath:AT1G08080

ath:AT4G20990

ath:AT5G04180

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.490

Rank 1 · LXL04_018501 · OH-1004

Plastid0.186

Rank 2 · LXL04_018501 · OH-1004

Lysosome / Vacuole0.136

Rank 3 · LXL04_018501 · OH-1004

Cytoplasm0.063

Rank 4 · LXL04_018501 · OH-1004

Endoplasmic reticulum0.056

Rank 5 · LXL04_018501 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00194.27Carb_anhydrase54-271 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_018501	`PF00194.27`	Carb_anhydrase	54	271	1.4e-38	133.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4JIK2`	Arabidopsis thaliana	Alpha carbonic anhydrase 4	37.597%	Swiss-Prot	moderate database homology
`Q8L817`	Arabidopsis thaliana	Alpha carbonic anhydrase 7	38.007%	Swiss-Prot	moderate database homology
`Q9FYE3`	Arabidopsis thaliana	Alpha carbonic anhydrase 3	38.618%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card