LXL04_018426 | RubberDandelionOmics

Gene overview

LXL04_018426

Reference: OH-1004 Chr: Chr04 Coordinates: 12728785-12731076 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2292 bp · LXL04_018426|LXL04_018426|OH1004|cDNA

ATGCTTGGAAGAAAGAAATCGTCAATCATTTTCGTTATCGTTTTTTTACCAGTGGTTTTTTCACAAATTCCATTGGGTTCAAAGCTATCGGTGGAGGATAAAAATCATTGGGCTTCTCGAAATGGGGATTTCGCAATTCGATTTTTTGATCGGTTAAATGAGTATGGAATTGGGATCCGTATAAACTCGGGTTTGATACCAGTTGAGAAACAACCGGTTGTTTGGGTTGCTGGTGGCGATTTAAGAGTTGGTGATAAATC...

CDS

Download CDS FASTA

2292 bp · LXL04_018426|LXL04_018426|OH1004|CDS

ATGCTTGGAAGAAAGAAATCGTCAATCATTTTCGTTATCGTTTTTTTACCAGTGGTTTTTTCACAAATTCCATTGGGTTCAAAGCTATCGGTGGAGGATAAAAATCATTGGGCTTCTCGAAATGGGGATTTCGCAATTCGATTTTTTGATCGGTTAAATGAGTATGGAATTGGGATCCGTATAAACTCGGGTTTGATACCAGTTGAGAAACAACCGGTTGTTTGGGTTGCTGGTGGCGATTTAAGAGTTGGTGATAAATC...

Protein

Download Protein FASTA

763 aa · LXL04_018426|LXL04_018426|OH1004|PROTEIN

MLGRKKSSIIFVIVFLPVVFSQIPLGSKLSVEDKNHWASRNGDFAIRFFDRLNEYGIGIRINSGLIPVEKQPVVWVAGGDLRVGDKSYFELTNNGDLVLFDSTRGVVVWASKTSNSSVAEAVLQDDGNLVLLNENKDIVWQSFGTPSDTLVPGQNLSSSQVLRAASRNSVSSFYSLRIGVIGDLELKWENDVVYWRSTARPNQSDLRAVLASNGALQLFDNVSSLVWSVFAEDHGESDVKFRFLRLDVDGNLRLHSWTRN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_018426`
TK1151 ID	TkA08G059360
OH-1004 ID	LXL04_018426
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.200
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_018426

Location Chr04:12728785-12731076 (+)

Description Similar to SD31: G-type lectin S-receptor-like serine/threonine-protein kinase SD3-1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g41890`	G-type lectin S-receptor-like serine/threonine-protein kinase SD3-1.	No verified direct reference in this release
`At1g34300`	G-type lectin S-receptor-like serine/threonine-protein kinase At1g34300.	No verified direct reference in this release
`At5g24080`	G-type lectin S-receptor-like serine/threonine-protein kinase At5g24080.	No verified direct reference in this release
`At2g19130`	G-type lectin S-receptor-like serine/threonine-protein kinase At2g19130.	No verified direct reference in this release
`At5g60900`	G-type lectin S-receptor-like serine/threonine-protein kinase RLK1.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018426 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0048544 recognition of pollen Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0004672 protein kinase activity Molecular Function

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0005516 calmodulin binding Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0030246 carbohydrate binding Molecular Function

GO:0031625 ubiquitin protein ligase binding Molecular Function

GO:0106310 protein serine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT1G34300

ath:AT2G19130

ath:AT2G41890

ath:AT5G24080

ath:AT5G60900

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.821

Rank 1 · LXL04_018426 · OH-1004

Endoplasmic reticulum0.088

Rank 2 · LXL04_018426 · OH-1004

Cytoplasm0.076

Rank 3 · LXL04_018426 · OH-1004

Nucleus0.045

Rank 4 · LXL04_018426 · OH-1004

Extracellular0.039

Rank 5 · LXL04_018426 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01453.31B_lectin73-161 aa

PF00954.26S_locus_glycop239-298 aa

PF07714.24PK_Tyr_Ser-Thr509-633 aa

PF00069.32Pkinase513-635 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_018426	`PF01453.31`	B_lectin	73	161	4e-23	82.6
LXL04_018426	`PF00954.26`	S_locus_glycop	239	298	6.7e-09	37.0
LXL04_018426	`PF07714.24`	PK_Tyr_Ser-Thr	509	633	3.9e-19	69.7
LXL04_018426	`PF00069.32`	Pkinase	513	635	5.3e-11	43.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P93756`	Arabidopsis thaliana	G-type lectin S-receptor-like serine/threonine-protein kinase SD3-1	48.148%	Swiss-Prot	moderate database homology
`Q9XID3`	Arabidopsis thaliana	G-type lectin S-receptor-like serine/threonine-protein kinase At1g34300	30.224%	Swiss-Prot	moderate database homology
`Q9FLV4`	Arabidopsis thaliana	G-type lectin S-receptor-like serine/threonine-protein kinase At5g24080	28.248%	Swiss-Prot	weak database homology
`O64477`	Arabidopsis thaliana	G-type lectin S-receptor-like serine/threonine-protein kinase At2g19130	28.084%	Swiss-Prot	weak database homology
`Q39202`	Arabidopsis thaliana	G-type lectin S-receptor-like serine/threonine-protein kinase RLK1	25.864%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card