LXL04_018323 | RubberDandelionOmics

Gene overview

LXL04_018323

Reference: OH-1004 Chr: Chr04 Coordinates: 11612309-11614549 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2241 bp · LXL04_018323|LXL04_018323|OH1004|cDNA

ATGAAGAAGATTTCGATACTTTTTTGTGTAGTTCTGTTTTCATTTTTGTCTGGTTGTGTGTTTTGTTTTTCCGATGATGGTGGTGGCTTGAGTTCTGGAAAGCTCACCGACGGTGAGGTGAGTTATATTCGTCAACGGCAACTGCTGTACTACCGGGATGAGTTCGGTGACAGAGGCGAGAATGTGAGCGTGGATCCGACGCTCGTGTTTGAAAACCCTCGGCTGAGGAATGCTTACATTGCTTTACAAGCTTGGAAGCA...

CDS

Download CDS FASTA

2241 bp · LXL04_018323|LXL04_018323|OH1004|CDS

ATGAAGAAGATTTCGATACTTTTTTGTGTAGTTCTGTTTTCATTTTTGTCTGGTTGTGTGTTTTGTTTTTCCGATGATGGTGGTGGCTTGAGTTCTGGAAAGCTCACCGACGGTGAGGTGAGTTATATTCGTCAACGGCAACTGCTGTACTACCGGGATGAGTTCGGTGACAGAGGCGAGAATGTGAGCGTGGATCCGACGCTCGTGTTTGAAAACCCTCGGCTGAGGAATGCTTACATTGCTTTACAAGCTTGGAAGCA...

Protein

Download Protein FASTA

746 aa · LXL04_018323|LXL04_018323|OH1004|PROTEIN

MKKISILFCVVLFSFLSGCVFCFSDDGGGLSSGKLTDGEVSYIRQRQLLYYRDEFGDRGENVSVDPTLVFENPRLRNAYIALQAWKQAILSDPQNLTANWVGSGVCDYTGVFCAPALDNSSERTVAGIDLNHGDIAGYLPEELGLLKDLALFHINSNRFCGTVPQKFRHLKLLYELDLSNNRFAGKFPYVVLKLPVLKFLDIRFNEFEGSVPKELFDKDLDAIFINHNRFLFELPDNFGNSPVSVIVLANNRFHGCLPAS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_018323`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_018323

Location Chr04:11612309-11614549 (-)

Description Similar to LRX4: Leucine-rich repeat extensin-like protein 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g24480`	Modulates cell morphogenesis by regulating cell wall formation and assembly, and/or growth polarization.	No verified direct reference in this release
`At4g18670`	Modulates cell morphogenesis by regulating cell wall formation and assembly, and/or growth polarization.	No verified direct reference in this release
`At4g13340`	Modulates cell morphogenesis by regulating cell wall formation and assembly, and/or growth polarization.	No verified direct reference in this release
`At1g49490`	Modulates cell morphogenesis by regulating cell wall formation and assembly, and/or growth polarization.	No verified direct reference in this release
`At5g25550`	Modulates cell morphogenesis by regulating cell wall formation and assembly, and/or growth polarization.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018323 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009860 pollen tube growth Biological Process

GO:0071555 cell wall organization Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0099503 secretory vesicle Cellular Component

GO:0005199 structural constituent of cell wall Molecular Function

GO:0042277 peptide binding Molecular Function

KEGG gene cross-reference

ath:AT1G49490

ath:AT3G24480

ath:AT4G13340

ath:AT4G18670

ath:AT5G25550

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.520

Rank 1 · LXL04_018323 · OH-1004

Cell membrane0.178

Rank 2 · LXL04_018323 · OH-1004

Endoplasmic reticulum0.161

Rank 3 · LXL04_018323 · OH-1004

Cytoplasm0.073

Rank 4 · LXL04_018323 · OH-1004

Plastid0.048

Rank 5 · LXL04_018323 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13855.13LRR_8150-206 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_018323	`PF13855.13`	LRR_8	150	206	1.1e-09	38.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LHF1`	Arabidopsis thaliana	Leucine-rich repeat extensin-like protein 4	70.690%	Swiss-Prot	moderate database homology
`Q9SN46`	Arabidopsis thaliana	Leucine-rich repeat extensin-like protein 5	69.077%	Swiss-Prot	moderate database homology
`Q9T0K5`	Arabidopsis thaliana	Leucine-rich repeat extensin-like protein 3	68.559%	Swiss-Prot	moderate database homology
`Q9XIB6`	Arabidopsis thaliana	Pollen-specific leucine-rich repeat extensin-like protein 2	49.695%	Swiss-Prot	moderate database homology
`Q4PSE6`	Arabidopsis thaliana	Leucine-rich repeat extensin-like protein 7	55.388%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card