LXL04_018125 | RubberDandelionOmics

Gene overview

LXL04_018125

Reference: OH-1004 Chr: Chr04 Coordinates: 6982108-6983617 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1059 bp · LXL04_018125|LXL04_018125|OH1004|cDNA

ATGGATGATGACAGCGATCGGAGCTCTGAAGCAACTCAACTGGAAGGACATTCAACAGCGGAGGATACGACGATGCACCCTCATTTCGACGATGACGCTACTCCATTACATACTTCTCCTACGTCACCCGAGGAAGATTCAACTACTTCTCAACCTTTAACCCTAGTAGTATCCGATTTATCAGACGTACCGGTAAAATACGAGATGCAACGCGATGAGTTGGAGCGCTTGAAGAATCAGCTTCAAGGGAGTCACCAAGA...

CDS

Download CDS FASTA

1059 bp · LXL04_018125|LXL04_018125|OH1004|CDS

ATGGATGATGACAGCGATCGGAGCTCTGAAGCAACTCAACTGGAAGGACATTCAACAGCGGAGGATACGACGATGCACCCTCATTTCGACGATGACGCTACTCCATTACATACTTCTCCTACGTCACCCGAGGAAGATTCAACTACTTCTCAACCTTTAACCCTAGTAGTATCCGATTTATCAGACGTACCGGTAAAATACGAGATGCAACGCGATGAGTTGGAGCGCTTGAAGAATCAGCTTCAAGGGAGTCACCAAGA...

Protein

Download Protein FASTA

352 aa · LXL04_018125|LXL04_018125|OH1004|PROTEIN

MDDDSDRSSEATQLEGHSTAEDTTMHPHFDDDATPLHTSPTSPEEDSTTSQPLTLVVSDLSDVPVKYEMQRDELERLKNQLQGSHQEALATVIAQAARSQISSLKCSNPQAQNHSQKNTTDYPKSSSPSHHVKIPTDGYNWRKYGQKQVKSPQGSRSYYKCTSTECDAKKIESCDQNNYVTKVVYKGHHKHDPPKKVFSGGKILSSPKSVKRKPISTPPLKEHRLCDQRVKNSVPKKPKYIVHAADDVGISADGYRWRKY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_018125`
TK1151 ID	TkA08G025890
OH-1004 ID	LXL04_018125
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.900
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_018125

Location Chr04:6982108-6983617 (-)

Description Similar to WRKY32: Probable WRKY transcription factor 32

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g30935`	Transcription factor.	No verified direct reference in this release
`At5g07100`	Transcription factor.	Arabidopsis thaliana WRKY25, WRKY26, and WRKY33 coordinate induction of plant thermotolerance.2011 · DOI: 10.1007/s00425-011-1375-2
`At3g01080`	Transcription factor.	No verified direct reference in this release
`At2g30250`	Transcription factor.	Functional characterization of Arabidopsis NaCl-inducible WRKY25 and WRKY33 transcription factors in abiotic stresses.2009 · DOI: 10.1007/s11103-008-9408-3 Functional analysis of an Arabidopsis transcription factor WRKY25 in heat stress.2009 · DOI: 10.1007/s00299-008-0666-y Arabidopsis thaliana WRKY25, WRKY26, and WRKY33 coordinate induction of plant thermotolerance.2011 · DOI: 10.1007/s00425-011-1375-2

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0826400`	May participate in transcriptional regulation of abscisic acid and gibberellin signaling.	Annotations and functional analyses of the rice WRKY gene superfamily reveal positive and negative regulators of abscisic acid signaling in aleurone cells.2005 · DOI: 10.1104/pp.104.054312 A negative regulator encoded by a rice WRKY gene represses both abscisic acid and gibberellins signaling in aleurone cells.2009 · DOI: 10.1007/s11103-009-9463-4

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018125 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0034605 cellular response to heat Biological Process

GO:0070370 cellular heat acclimation Biological Process

GO:0005634 nucleus Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT4G30935

ath:AT5G07100

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.934

Rank 1 · LXL04_018125 · OH-1004

Cytoplasm0.169

Rank 2 · LXL04_018125 · OH-1004

Mitochondrion0.024

Rank 3 · LXL04_018125 · OH-1004

Cell membrane0.018

Rank 4 · LXL04_018125 · OH-1004

Endoplasmic reticulum0.008

Rank 5 · LXL04_018125 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03106.22WRKY137-192 aa

PF03106.22WRKY253-309 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_018125	`PF03106.22`	WRKY	137	192	3.2e-41	140.1
LXL04_018125	`PF03106.22`	WRKY	253	309	3.2e-41	140.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P59583`	Arabidopsis thaliana	Probable WRKY transcription factor 32	46.309%	Swiss-Prot	moderate database homology
`Q9C5T3`	Arabidopsis thaliana	Probable WRKY transcription factor 26	45.455%	Swiss-Prot	moderate database homology
`Q93WU7`	Arabidopsis thaliana	Probable WRKY transcription factor 58	40.909%	Swiss-Prot	weak database homology
`O22921`	Arabidopsis thaliana	Probable WRKY transcription factor 25	34.568%	Swiss-Prot	moderate database homology
`Q6IEQ7`	Oryza sativa subsp. japonica	WRKY transcription factor WRKY24	31.560%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card