LXL04_017987 | RubberDandelionOmics

Gene overview

LXL04_017987

Reference: OH-1004 Chr: Chr04 Coordinates: 4667840-4669535 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

726 bp · LXL04_017987|LXL04_017987|OH1004|cDNA

ATGAACGAAGAAGTGATGTGCGACACAACATTAGCTCTTGGGATTGGAGTGGGGATGCAAAGGGAGAGGCAATCAAAGCAACACAAGAGGGGTGTTTGGTTGAATCTTTCATTGCCACTTCATCCAAAGATTGAAGCTAGTGATGATCATGACCATGATTACCATAATGACAATGATGATCAAGACTCTAATTTTAGTTCTAAAACCATTGATGATCACGAAGAACAAGAAGAGAGAGGGATAAAACGAAGCGCTAGCAA...

CDS

Download CDS FASTA

726 bp · LXL04_017987|LXL04_017987|OH1004|CDS

ATGAACGAAGAAGTGATGTGCGACACAACATTAGCTCTTGGGATTGGAGTGGGGATGCAAAGGGAGAGGCAATCAAAGCAACACAAGAGGGGTGTTTGGTTGAATCTTTCATTGCCACTTCATCCAAAGATTGAAGCTAGTGATGATCATGACCATGATTACCATAATGACAATGATGATCAAGACTCTAATTTTAGTTCTAAAACCATTGATGATCACGAAGAACAAGAAGAGAGAGGGATAAAACGAAGCGCTAGCAA...

Protein

Download Protein FASTA

241 aa · LXL04_017987|LXL04_017987|OH1004|PROTEIN

MNEEVMCDTTLALGIGVGMQRERQSKQHKRGVWLNLSLPLHPKIEASDDHDHDYHNDNDDQDSNFSSKTIDDHEEQEERGIKRSASNTDVYNNNSDGSRKKLKLTTEQTTSLENSFKINSTLNTGQKHELAKKLNLLPRQIEVWFQNRRARTKLKQIEQECALLKKCCETLNEENRRLKKELQEVRCYSIKFDQPPYPPLPFYIRYATTAEMLHPCDQDTKTVILPNGGSIAQSHAPVKLS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_017987`
TK1151 ID	TkA08G034980
OH-1004 ID	LXL04_017987
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	80.100
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_017987

Location Chr04:4667840-4669535 (+)

Description Similar to HOX19: Homeobox-leucine zipper protein HOX19

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g06710`	Probable transcription factor.	No verified direct reference in this release
`At4g37790`	Probable transcription factor.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0231000`	Probable transcription factor.	No verified direct reference in this release
`UniProt: A2XE76`	Probable transcription factor.	No verified direct reference in this release
`UniProt: A2Z1U1`	Probable transcription factor.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017987 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009735 response to cytokinin Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0005634 nucleus Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific Molecular Function

GO:0001217 DNA-binding transcription repressor activity Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

GO:0043565 sequence-specific DNA binding Molecular Function

KEGG gene cross-reference

ath:AT4G37790

ath:AT5G06710

dosa:Os03g0231000

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.982

Rank 1 · LXL04_017987 · OH-1004

Cytoplasm0.071

Rank 2 · LXL04_017987 · OH-1004

Cell membrane0.022

Rank 3 · LXL04_017987 · OH-1004

Endoplasmic reticulum0.013

Rank 4 · LXL04_017987 · OH-1004

Plastid0.009

Rank 5 · LXL04_017987 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00046.36Homeodomain99-153 aa

PF02183.24HALZ155-185 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_017987	`PF00046.36`	Homeodomain	99	153	4.3e-16	59.2
LXL04_017987	`PF02183.24`	HALZ	155	185	7.7e-07	29.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P46665`	Arabidopsis thaliana	Homeobox-leucine zipper protein HAT14	51.592%	Swiss-Prot	moderate database homology
`P46604`	Arabidopsis thaliana	Homeobox-leucine zipper protein HAT22	48.684%	Swiss-Prot	moderate database homology
`Q8GRL4`	Oryza sativa subsp. japonica	Homeobox-leucine zipper protein HOX19	51.592%	Swiss-Prot	moderate database homology
`A2XE76`	Oryza sativa subsp. indica	Homeobox-leucine zipper protein HOX19	51.592%	Swiss-Prot	moderate database homology
`A2Z1U1`	Oryza sativa subsp. indica	Homeobox-leucine zipper protein HOX11	57.143%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card