LXL04_017940 | RubberDandelionOmics

Gene overview

LXL04_017940

Reference: OH-1004 Chr: Chr04 Coordinates: 4026465-4028847 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1656 bp · LXL04_017940|LXL04_017940|OH1004|cDNA

ATGGTCCACGTTCTACTGAACCGTAGTCGCTACGTCTCTGTTCCTCTTTCTACACACACAACCGGCAGCCCCATCGACACTCGTTCTTCTTCAAGTTATGAGCACTGGTTCGGAGTGAGCGACTTCGTGGTACCGGCCTCATCGCTGATCGCTTTTCAGTTTGAGCTCATTCAAGGTATACCAATGGCAGCTATAGTCATGACAGACCAAAGATCTACATATACACTAGATGAAGCACTTGTGGCCATCGGATTTGGAAA...

CDS

Download CDS FASTA

1656 bp · LXL04_017940|LXL04_017940|OH1004|CDS

ATGGTCCACGTTCTACTGAACCGTAGTCGCTACGTCTCTGTTCCTCTTTCTACACACACAACCGGCAGCCCCATCGACACTCGTTCTTCTTCAAGTTATGAGCACTGGTTCGGAGTGAGCGACTTCGTGGTACCGGCCTCATCGCTGATCGCTTTTCAGTTTGAGCTCATTCAAGGTATACCAATGGCAGCTATAGTCATGACAGACCAAAGATCTACATATACACTAGATGAAGCACTTGTGGCCATCGGATTTGGAAA...

Protein

Download Protein FASTA

551 aa · LXL04_017940|LXL04_017940|OH1004|PROTEIN

MVHVLLNRSRYVSVPLSTHTTGSPIDTRSSSSYEHWFGVSDFVVPASSLIAFQFELIQGIPMAAIVMTDQRSTYTLDEALVAIGFGKYQGWIIAYAGLGSIAEAMEVMILSFIGPSVRSEWNLSSTQESLITTVVFAGMLIGAYTWGAISDNFGRRKGLLSIAIVTSGASLLSAFSPNYISLVTLRCIGGIGLGGGPTYNSWFLEFVPVPSRGRWMVIFATFWTIGTIAEASLAWIIMPRFGWRWLLAISSLPAIFALVF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_017940`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_017940

Location Chr04:4026465-4028847 (-)

Description Similar to OCT7: Organic cation/carnitine transporter 7

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g13050`	High affinity carnitine transporter involved in the active cellular uptake of carnitine.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017940 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006811 monoatomic ion transport Biological Process

GO:0042908 xenobiotic transport Biological Process

GO:2001142 nicotinate transport Biological Process

GO:2001143 N-methylnicotinate transport Biological Process

GO:0005886 plasma membrane Cellular Component

GO:0009925 basal plasma membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0005524 ATP binding Molecular Function

GO:0022857 transmembrane transporter activity Molecular Function

GO:0090416 nicotinate transmembrane transporter activity Molecular Function

GO:0090417 N-methylnicotinate transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT3G13050

cel:CELE_ZK637.1

hsa:55530

pon:100173685

xla:734235

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.483

Rank 1 · LXL04_017940 · OH-1004

Cell membrane0.179

Rank 2 · LXL04_017940 · OH-1004

Endoplasmic reticulum0.146

Rank 3 · LXL04_017940 · OH-1004

Golgi apparatus0.114

Rank 4 · LXL04_017940 · OH-1004

Cytoplasm0.097

Rank 5 · LXL04_017940 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07690.22MFS_198-372 aa

PF00083.31Sugar_tr118-542 aa

PF07690.22MFS_1401-533 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_017940	`PF07690.22`	MFS_1	98	372	8.4e-36	124.3
LXL04_017940	`PF00083.31`	Sugar_tr	118	542	6.5e-37	128.2
LXL04_017940	`PF07690.22`	MFS_1	401	533	8.4e-36	124.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q940M4`	Arabidopsis thaliana	Organic cation/carnitine transporter 7	56.795%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card