LXL04_017921 | RubberDandelionOmics

Gene overview

LXL04_017921

Reference: OH-1004 Chr: Chr04 Coordinates: 3665628-3672384 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1641 bp · LXL04_017921|LXL04_017921|OH1004|cDNA

ATGGTGATCTTTTCCTTTGTAGGAAAGAAACTAGAACAACTTTGTAGTTCCTGTTTCCAGGCCTTGAGCTATTTCAAAATTTTATGTTTGCCAATCATTTTTTTCTATCATTATGTGTTGCGTCGTATGAACCAATTCTTTATCGAAGTTTTCTATtttctctttatttctttcttGGGTTTTCTTATCCTCAATGCAATGGATCCACGAACCCCGACATTTACTCCTAGAAAGTTAGACTTATTCTTCACCTCAGTCTC...

CDS

Download CDS FASTA

1641 bp · LXL04_017921|LXL04_017921|OH1004|CDS

ATGGTGATCTTTTCCTTTGTAGGAAAGAAACTAGAACAACTTTGTAGTTCCTGTTTCCAGGCCTTGAGCTATTTCAAAATTTTATGTTTGCCAATCATTTTTTTCTATCATTATGTGTTGCGTCGTATGAACCAATTCTTTATCGAAGTTTTCTATTTTCTCTTTATTTCTTTCTTGGGTTTTCTTATCCTCAATGCAATGGATCCACGAACCCCGACATTTACTCCTAGAAAGTTAGACTTATTCTTCACCTCAGTCTC...

Protein

Download Protein FASTA

546 aa · LXL04_017921|LXL04_017921|OH1004|PROTEIN

MVIFSFVGKKLEQLCSSCFQALSYFKILCLPIIFFYHYVLRRMNQFFIEVFYFLFISFLGFLILNAMDPRTPTFTPRKLDLFFTSVSASTVSSMSVIEMEVFSNSQLITMTILMFIGGEVFTSMVALLLRSFSRRSSIKQGGRVNDSMSDLGIPPNFHSQLELGTIANPEFESSKSDIFDFYDQEPMDDDYSDQLKFKSIKFLGLLVLGYLLLVQILGIVSVFVYLNVISSAKNVLEQKGLKTFTFSLFTVVSTFASCGF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_017921`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_017921

Location Chr04:3665628-3672384 (+)

Description Similar to HKT1: Sodium transporter HKT1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g10310`	Sodium transporter protein, which plays a central role in plant tolerance to salt.	The Arabidopsis HKT1 gene homolog mediates inward Na(+) currents in xenopus laevis oocytes and Na(+) uptake in Saccharomyces cerevisiae.2000 · DOI: 10.1104/pp.122.4.1249 AtHKT1 is a salt tolerance determinant that controls Na(+) entry into plant roots.2001 · DOI: 10.1073/pnas.241501798 Glycine residues in potassium channel-like selectivity filters determine potassium selectivity in four-loop-per-subunit HKT transporters from plants.2002 · DOI: 10.1073/pnas.082123799 Altered shoot/root Na+ distribution and bifurcating salt sensitivity in Arabidopsis by genetic disruption of the Na+ transporter AtHKT1.2002 · DOI: 10.1016/s0014-5793(02)03488-9 Functional analysis of AtHKT1 in Arabidopsis shows that Na(+) recirculation by the phloem is crucial for salt tolerance.2003 · DOI: 10.1093/emboj/cdg207 AtHKT1 facilitates Na+ homeostasis and K+ nutrition in planta.2004 · DOI: 10.1104/pp.104.042234 Microarray-based rapid cloning of an ion accumulation deletion mutant in Arabidopsis thaliana.2004 · DOI: 10.1073/pnas.0404780101

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0175000`	Functions as a highly-selective sodium transporter.	Diversity in expression patterns and functional properties in the rice HKT transporter family.2009 · DOI: 10.1104/pp.109.138008 Identification of rice cornichon as a possible cargo receptor for the Golgi-localized sodium transporter OsHKT1;3.2015 · DOI: 10.1093/jxb/erv069
`UniProt: A2WNZ9`	Sodium transporter that under salt stress mediates sodium exclusion in the phloem to prevent sodium transfer to young leaf blades and reproductive tissues (By similarity).	No verified direct reference in this release
`UniProt: Q93XI5`	Seems to be involved in regulation of potassium-sodium homeostasis.	No verified direct reference in this release
`Os01g0307500`	Sodium transporter that under salt stress mediates sodium exclusion in the phloem to prevent sodium transfer to young leaf blades and reproductive tissues.	OsHKT1;5 mediates Na+ exclusion in the vasculature to protect leaf blades and reproductive tissues from salt toxicity in rice.2017 · DOI: 10.1111/tpj.13595

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017921 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006813 potassium ion transport Biological Process

GO:0006814 sodium ion transport Biological Process

GO:0006970 response to osmotic stress Biological Process

GO:0009651 response to salt stress Biological Process

GO:0035725 sodium ion transmembrane transport Biological Process

GO:2000649 regulation of sodium ion transmembrane transporter activity Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0008324 monoatomic cation transmembrane transporter activity Molecular Function

GO:0015079 potassium ion transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT4G10310

dosa:Os01g0307500

dosa:Os02g0175000

osa:4328468

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.654

Rank 1 · LXL04_017921 · OH-1004

Lysosome / Vacuole0.126

Rank 2 · LXL04_017921 · OH-1004

Endoplasmic reticulum0.121

Rank 3 · LXL04_017921 · OH-1004

Cytoplasm0.104

Rank 4 · LXL04_017921 · OH-1004

Mitochondrion0.055

Rank 5 · LXL04_017921 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02386.23TrkH181-533 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_017921	`PF02386.23`	TrkH	181	533	6.9e-30	104.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q84TI7`	Arabidopsis thaliana	Sodium transporter HKT1	47.010%	Swiss-Prot	moderate database homology
`Q6H501`	Oryza sativa subsp. japonica	Cation transporter HKT1;3	45.743%	Swiss-Prot	moderate database homology
`A2WNZ9`	Oryza sativa subsp. indica	Cation transporter HKT1;5	42.458%	Swiss-Prot	moderate database homology
`Q93XI5`	Oryza sativa subsp. indica	Cation transporter HKT2;2	39.458%	Swiss-Prot	moderate database homology
`Q0JNB6`	Oryza sativa subsp. japonica	Cation transporter HKT1;5	42.458%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card