LXL04_017900 | RubberDandelionOmics

Gene overview

LXL04_017900

Reference: OH-1004 Chr: Chr04 Coordinates: 3181501-3184241 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1158 bp · LXL04_017900|LXL04_017900|OH1004|cDNA

ATGGCTGTTACATCTGGAAATGGGGGAAAGCTTCAAGAAGGGGCGGTTGTGAATGGAGGTGTAGGTGGTGAAGATGTGCGATTTGACCCTTCTGCCCCTCCTCCTTTTAGGGTGGCTGAAATCAGAGCTGCCATTCCTAAGCATTGTTGGGTCAAGAATCCATGGAGGTCGATGGCGTATGTCGTCAGGGACATTTTGGTCATTTCGTCTTTGGTCGCCATGGCTGTGTACCTAAAGAACTTTACTTGGGTTTTCTGGCC...

CDS

Download CDS FASTA

1158 bp · LXL04_017900|LXL04_017900|OH1004|CDS

ATGGCTGTTACATCTGGAAATGGGGGAAAGCTTCAAGAAGGGGCGGTTGTGAATGGAGGTGTAGGTGGTGAAGATGTGCGATTTGACCCTTCTGCCCCTCCTCCTTTTAGGGTGGCTGAAATCAGAGCTGCCATTCCTAAGCATTGTTGGGTCAAGAATCCATGGAGGTCGATGGCGTATGTCGTCAGGGACATTTTGGTCATTTCGTCTTTGGTCGCCATGGCTGTGTACCTAAAGAACTTTACTTGGGTTTTCTGGCC...

Protein

Download Protein FASTA

385 aa · LXL04_017900|LXL04_017900|OH1004|PROTEIN

MAVTSGNGGKLQEGAVVNGGVGGEDVRFDPSAPPPFRVAEIRAAIPKHCWVKNPWRSMAYVVRDILVISSLVAMAVYLKNFTWVFWPVYWVAQGTMFWAIFVLGHDCGHGSFSDSATLNNIVGHILHSAILVPYHGWRISHRTHHQNHGHVENDESWVPIPEKTYKTLDTSTKFFRFKIPFPLFAYPLYLLKRSPGKSGSHFNPYSEIFSPNERRYIVTSTICWGVMVGLLFYLGNLIGPMPLFNIYGIPYLIFVAWLDI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_017900`
TK1151 ID	TkA08G041930
OH-1004 ID	LXL04_017900
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_017900

Location Chr04:3181501-3184241 (-)

Description Similar to FAD3: Omega-3 fatty acid desaturase, endoplasmic reticulum

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g05580`	Chloroplast omega-3 fatty acid desaturase introduces the third double bond in the biosynthesis of 16:3 and 18:3 fatty acids, important constituents of plant membranes.	Cloning of a temperature-regulated gene encoding a chloroplast omega-3 desaturase from Arabidopsis thaliana.1994 · DOI: 10.1104/pp.106.4.1615

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017900 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006633 fatty acid biosynthetic process Biological Process

GO:0006636 unsaturated fatty acid biosynthetic process Biological Process

GO:0009266 response to temperature stimulus Biological Process

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0031969 chloroplast membrane Cellular Component

GO:0016491 oxidoreductase activity Molecular Function

GO:0016717 oxidoreductase activity, acting on paired donors, with oxidation of a pair of donors resulting in the reduction of molecular oxygen to two molecules of water Molecular Function

GO:0042389 omega-3 fatty acid desaturase activity Molecular Function

GO:0102993 sn-2 acyl-lipid omega-3 desaturase (ferredoxin) activity Molecular Function

KEGG gene cross-reference

ath:AT5G05580

nta:107763446

rcu:8265360

sind:105167042

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.860

Rank 1 · LXL04_017900 · OH-1004

Cytoplasm0.071

Rank 2 · LXL04_017900 · OH-1004

Cell membrane0.060

Rank 3 · LXL04_017900 · OH-1004

Nucleus0.055

Rank 4 · LXL04_017900 · OH-1004

Golgi apparatus0.050

Rank 5 · LXL04_017900 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF11960.14DUF347418-73 aa

PF00487.31FA_desaturase83-337 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_017900	`PF11960.14`	DUF3474	18	73	2.4e-27	96.6
LXL04_017900	`PF00487.31`	FA_desaturase	83	337	1.4e-32	114.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P48622`	Arabidopsis thaliana	Temperature-sensitive sn-2 acyl-lipid omega-3 desaturase (ferredoxin), chloroplastic	68.698%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card