LXL04_016985 | RubberDandelionOmics

Gene overview

LXL04_016985

Reference: OH-1004 Chr: Chr03 Coordinates: 138396057-138400914 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

4161 bp · LXL04_016985|LXL04_016985|OH1004|cDNA

atgTGGATGTGGCGACGCCGTAAGCAAAATCGTTCGGACCGGTTATCCAAACCGCCCAATTTGCCAACCAAGACCGGATCCTCTAGCAAAGAAACCGGATCATCGTCCTCAAAGGGTCAAATTTGCCGTCGATTTACAATCGCTGAGATTCGATCCGCTACCCAAGACTTCAACCAAAGCTTGCTAATAGGGAGAGGCGGATTCGGGAGCGTGTACAAAGGTACAATCAAGGATGGAACACTACTCACGGTGGCTCTTAA...

CDS

Download CDS FASTA

4161 bp · LXL04_016985|LXL04_016985|OH1004|CDS

ATGTGGATGTGGCGACGCCGTAAGCAAAATCGTTCGGACCGGTTATCCAAACCGCCCAATTTGCCAACCAAGACCGGATCCTCTAGCAAAGAAACCGGATCATCGTCCTCAAAGGGTCAAATTTGCCGTCGATTTACAATCGCTGAGATTCGATCCGCTACCCAAGACTTCAACCAAAGCTTGCTAATAGGGAGAGGCGGATTCGGGAGCGTGTACAAAGGTACAATCAAGGATGGAACACTACTCACGGTGGCTCTTAA...

Protein

Download Protein FASTA

1386 aa · LXL04_016985|LXL04_016985|OH1004|PROTEIN

MWMWRRRKQNRSDRLSKPPNLPTKTGSSSKETGSSSSKGQICRRFTIAEIRSATQDFNQSLLIGRGGFGSVYKGTIKDGTLLTVALKRWNFTSNQGVSEFEMEIDLLPMLRHPNIVYLIGFCNDGKELILVYEYMSNGSLKDHLHKHRTPLSWSQRLKICINVASALEYLHNGTSGQEVIYNNVKSANILLDDQWAAKIADFRISTIIPFDNDSTHVSTDVKGTLGYFDPEYAATGRLSKKSDVYSFGVVMLEVLCRRPP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_016985`
TK1151 ID	TkA02G085680
OH-1004 ID	LXL04_016985
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_016985

Location Chr03:138396057-138400914 (+)

Description Similar to ANX2: Receptor-like protein kinase ANXUR2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g28680`	Receptor-like protein kinase that controls pollen tube behavior by directing rupture at proper timing to release the sperm cell.	No verified direct reference in this release
`At5g38990`	Probable receptor-like protein kinase At5g38990.	No verified direct reference in this release
`At3g51550`	May regulate MLO7 polarization in female gametophyte synergid cells to control pollen tube growth and male gamete delivery during fertilization.	FERONIA receptor-like kinase regulates RHO GTPase signaling of root hair development.2010 · DOI: 10.1073/pnas.1005366107
`At3g04690`	Receptor-like protein kinase that controls pollen tube behavior by directing rupture at proper timing to release the sperm cell.	No verified direct reference in this release
`At4g39110`	Probable receptor-like protein kinase At4g39110.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_016985 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009555 pollen development Biological Process

GO:0009723 response to ethylene Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009741 response to brassinosteroid Biological Process

GO:0009742 brassinosteroid mediated signaling pathway Biological Process

GO:0009788 negative regulation of abscisic acid-activated signaling pathway Biological Process

GO:0009791 post-embryonic development Biological Process

GO:0009873 ethylene-activated signaling pathway Biological Process

GO:0010038 response to metal ion Biological Process

GO:0010118 stomatal movement Biological Process

GO:0010483 pollen tube reception Biological Process

GO:0030308 negative regulation of cell growth Biological Process

KEGG gene cross-reference

ath:AT3G04690

ath:AT3G51550

ath:AT4G39110

ath:AT5G28680

ath:AT5G38990

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.497

Rank 1 · LXL04_016985 · OH-1004

Cytoplasm0.269

Rank 2 · LXL04_016985 · OH-1004

Nucleus0.263

Rank 3 · LXL04_016985 · OH-1004

Endoplasmic reticulum0.064

Rank 4 · LXL04_016985 · OH-1004

Plastid0.049

Rank 5 · LXL04_016985 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069.32Pkinase60-327 aa

PF07714.24PK_Tyr_Ser-Thr62-327 aa

PF23598.2LRR_14876-1146 aa

PF13855.13LRR_8897-955 aa

PF23247.2LRR_RPS21170-1259 aa

PF23247.2LRR_RPS21217-1331 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_016985	`PF00069.32`	Pkinase	60	327	2.5e-42	145.8
LXL04_016985	`PF07714.24`	PK_Tyr_Ser-Thr	62	327	8.7e-45	153.7
LXL04_016985	`PF23598.2`	LRR_14	876	1146	2.9e-13	50.0
LXL04_016985	`PF13855.13`	LRR_8	897	955	1.5e-07	31.8
LXL04_016985	`PF23247.2`	LRR_RPS2	1170	1259	1.8e-19	71.0
LXL04_016985	`PF23247.2`	LRR_RPS2	1217	1331	1.8e-19	71.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q3E8W4`	Arabidopsis thaliana	Receptor-like protein kinase ANXUR2	45.342%	Swiss-Prot	weak database homology
`Q9FID9`	Arabidopsis thaliana	Probable receptor-like protein kinase At5g38990	45.821%	Swiss-Prot	weak database homology
`Q9SCZ4`	Arabidopsis thaliana	Receptor-like protein kinase FERONIA	44.160%	Swiss-Prot	weak database homology
`Q9SR05`	Arabidopsis thaliana	Receptor-like protein kinase ANXUR1	45.625%	Swiss-Prot	weak database homology
`Q9T020`	Arabidopsis thaliana	Probable receptor-like protein kinase At4g39110	44.413%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card