Gene Card
Gene overview
cDNA / CDS / Protein Sequences
465 bp · LXL04_016356|LXL04_016356|OH1004|cDNA
ATGGCTATTAAACAAGAAAATCTTATTCGTCCCATTGCAAATTTCCCTCCTTCCATTTGGGGAGACCAGTTTCTTGTCTATGAGCAGCAAGAAGAGCAAGATGGGGTTGAGCAAGTAGTTGAAGACTTGAAAGAAGAAGTCAAGAAAGAATTATTGGCAACATTGAATGTTCCAGTTGAGCATGCAAATTTGTTAAGACTAATCGATGCAATCCAACGCCTTGGCATAGCATATTACTTTGAAGAGGAGATTAATCAATC...
465 bp · LXL04_016356|LXL04_016356|OH1004|CDS
ATGGCTATTAAACAAGAAAATCTTATTCGTCCCATTGCAAATTTCCCTCCTTCCATTTGGGGAGACCAGTTTCTTGTCTATGAGCAGCAAGAAGAGCAAGATGGGGTTGAGCAAGTAGTTGAAGACTTGAAAGAAGAAGTCAAGAAAGAATTATTGGCAACATTGAATGTTCCAGTTGAGCATGCAAATTTGTTAAGACTAATCGATGCAATCCAACGCCTTGGCATAGCATATTACTTTGAAGAGGAGATTAATCAATC...
Protein
Download Protein FASTA154 aa · LXL04_016356|LXL04_016356|OH1004|PROTEIN
MAIKQENLIRPIANFPPSIWGDQFLVYEQQEEQDGVEQVVEDLKEEVKKELLATLNVPVEHANLLRLIDAIQRLGIAYYFEEEINQSLQYIYAAYGDDWNGDCTSLWFRLMRQEGFYVSSGSFKINNFCEIVRFNLDRWIELNTEEKRDAVAFL
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_016356 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_016356 |
|---|---|
| Location | Chr03:120117860-120119085 (-) |
| Description | Similar to Alpha-isocomene synthase |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0000302 response to reactive oxygen species Biological Process GO:0009739 response to gibberellin Biological Process GO:0016102 diterpenoid biosynthetic process Biological Process GO:0051761 sesquiterpene metabolic process Biological Process GO:0051762 sesquiterpene biosynthetic process Biological Process GO:0005737 cytoplasm Cellular Component GO:0000287 magnesium ion binding Molecular Function GO:0010333 terpene synthase activity Molecular Function GO:0034006 amorpha-4,11-diene synthase activity Molecular Function GO:0052682 epi-cedrol synthase activity Molecular Function GO:0080016 (-)-E-beta-caryophyllene synthase activity Molecular Function |
| KEGG gene cross-reference | ag:AAF80333 ag:AAF98444 ag:AAL79181 ag:AFM43735 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF01397.28Terpene_synth19-124 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_016356 | PF01397.28 | Terpene_synth | 19 | 124 | 2.6e-25 | 89.9 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.