LXL04_016116 | RubberDandelionOmics

Gene overview

LXL04_016116

Reference: OH-1004 Chr: Chr03 Coordinates: 111014369-111022952 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

5717 bp · LXL04_016116|LXL04_016116|OH1004|cDNA

GGTAAAAATAGAAACTTAGCGATAATTTTCAATTTCGAGTAGAGATATAGAGAACGGAGCACCCGAAAGTCCACGGTGTTCCTGTTAATCAAAAACAAAAAGCTTTTATGATTGTTGCTAATCAACTCCACCCCAAGCTTCTTCCACTGCCGACTTGGGTTGCCGGTCACCCGTTCCCTTCCTTACCCACTCACATATCTAGTACCCGTTTGCTCTAAATTTCCAATCTCTGTCTTGCTCAGAAAGAAAAAGACCAACCC...

CDS

Download CDS FASTA

5391 bp · LXL04_016116|LXL04_016116|OH1004|CDS

ATGCATCGCTATAACGCCTGGCTCCCACCTCCGGTCGCCGACGCCACCAAGAAAGAGCGAGAATCCTTCGCTCGTGTTGTATCATCCGTGAAAGAGTCGTATACTACGGGTGATCCAGAATCTGTCTACTCCACTCTCAAATGGATATCAGTCATTGACCTATTTGTAAAGGCAAAGAGTGAAGTATCACTGGAAGATGTTTCCATTCTTGTGGAATTTGGTCTGCAAGTGTTTCATTCATCACAAGACAAGCTTTATGC...

Protein

Download Protein FASTA

1796 aa · LXL04_016116|LXL04_016116|OH1004|PROTEIN

MHRYNAWLPPPVADATKKERESFARVVSSVKESYTTGDPESVYSTLKWISVIDLFVKAKSEVSLEDVSILVEFGLQVFHSSQDKLYAQVRWGNVLVSLLNKFRKKLTLKVDWRPFYDTLIQTHFIRNTGPEGWRIRQRHFETVTSLVRSCRRFFPPNSAHEIWTEFRSLLENPWHNSAFEGSGFVRLFLPTNLDNQNFYSREWINACILQWDSIPNCPFWNSQWAAIIARVIKNYKSNDWEDLVPEIFSRFLNMFEVPVA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_016116`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_016116

Location Chr03:111014369-111022952 (+)

Description Similar to PA200: Proteasome activator subunit 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g13330`	Associated component of the proteasome that specifically recognizes acetylated histones and promotes ATP- and ubiquitin-independent degradation of core histones during DNA damage response.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_016116 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006281 DNA repair Biological Process

GO:0006974 DNA damage response Biological Process

GO:0010499 proteasomal ubiquitin-independent protein catabolic process Biological Process

GO:0030317 flagellated sperm motility Biological Process

GO:0035092 sperm DNA condensation Biological Process

GO:0000502 proteasome complex Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0016607 nuclear speck Cellular Component

GO:0016504 peptidase activator activity Molecular Function

GO:0070628 proteasome binding Molecular Function

KEGG gene cross-reference

ath:AT3G13330

hsa:23198

mmu:103554

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.570

Rank 1 · LXL04_016116 · OH-1004

Cytoplasm0.410

Rank 2 · LXL04_016116 · OH-1004

Golgi apparatus0.043

Rank 3 · LXL04_016116 · OH-1004

Mitochondrion0.038

Rank 4 · LXL04_016116 · OH-1004

Endoplasmic reticulum0.038

Rank 5 · LXL04_016116 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF16507.12HEAT_PSME4_mid310-503 aa

PF16507.12HEAT_PSME4_mid515-822 aa

PF11919.14PSME4_C1711-1796 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_016116	`PF16507.12`	HEAT_PSME4_mid	310	503	3.6e-56	191.7
LXL04_016116	`PF16507.12`	HEAT_PSME4_mid	515	822	3.6e-56	191.7
LXL04_016116	`PF11919.14`	PSME4_C	1711	1796	6.7e-28	97.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4JC97`	Arabidopsis thaliana	Proteasome activator subunit 4	69.070%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card