LXL04_015908 | RubberDandelionOmics

Gene overview

LXL04_015908

Reference: OH-1004 Chr: Chr03 Coordinates: 97474342-97475767 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

504 bp · LXL04_015908|LXL04_015908|OH1004|cDNA

ATGGTCAGGTTAGGTTACCGGCTGCAGAGGATTACTAGAAGATGGTGGTATCTTATTGGTCAGAAAAGTCATAGTTATCTGCTGCTGCTGATGATCAAGAGGCATGTTCGAAGGCTGAAGCTGTTGACCTTCCTGTTGACTGCTATGGAGTTCCGGTTTAACTGTCATCTTATACACCTTCAGCAGAATATTTTCATCGAGTACATAATGCTGGATGGTGTGAATGATGAGGAGCAGCATGCCCACCAGCTTGGTAGACT...

CDS

Download CDS FASTA

504 bp · LXL04_015908|LXL04_015908|OH1004|CDS

ATGGTCAGGTTAGGTTACCGGCTGCAGAGGATTACTAGAAGATGGTGGTATCTTATTGGTCAGAAAAGTCATAGTTATCTGCTGCTGCTGATGATCAAGAGGCATGTTCGAAGGCTGAAGCTGTTGACCTTCCTGTTGACTGCTATGGAGTTCCGGTTTAACTGTCATCTTATACACCTTCAGCAGAATATTTTCATCGAGTACATAATGCTGGATGGTGTGAATGATGAGGAGCAGCATGCCCACCAGCTTGGTAGACT...

Protein

Download Protein FASTA

167 aa · LXL04_015908|LXL04_015908|OH1004|PROTEIN

MVRLGYRLQRITRRWWYLIGQKSHSYLLLLMIKRHVRRLKLLTFLLTAMEFRFNCHLIHLQQNIFIEYIMLDGVNDEEQHAHQLGRLLDTFEVVSPKHVEFGFAIAFLQSWDLFCTAFCAALPYQTVSYIAEHVIGTGSFGVVFEAKCRETGEIVAIKKVLKSKNIL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_015908`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_015908

Location Chr03:97474342-97475767 (+)

Description Similar to ASK4: Shaggy-related protein kinase delta

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g57870`	May mediate extracellular signals to regulate transcription in differentiating cells.	No verified direct reference in this release
`At1g09840`	May mediate extracellular signals to regulate transcription in differentiating cells.	No verified direct reference in this release
`At4g18710`	Negative regulator in brassinosteroid signal transduction pathway important for plant growth.	Regulation of brassinosteroid signaling by a GSK3/SHAGGY-like kinase.2002 · DOI: 10.1126/science.1065769 The GSK3-like kinase BIN2 phosphorylates and destabilizes BZR1, a positive regulator of the brassinosteroid signaling pathway in Arabidopsis.2002 · DOI: 10.1073/pnas.152342599 Two putative BIN2 substrates are nuclear components of brassinosteroid signaling.2002 · DOI: 10.1104/pp.102.010918 Brassinosteroid regulates stomatal development by GSK3-mediated inhibition of a MAPK pathway.2012 · DOI: 10.1038/nature10794 SPEECHLESS integrates brassinosteroid and stomata signalling pathways.2012 · DOI: 10.1038/ncb2471 Brassinosteroid-regulated GSK3/Shaggy-like kinases phosphorylate mitogen-activated protein (MAP) kinase kinases, which control stomata development in Arabidopsis thaliana.2013 · DOI: 10.1074/jbc.m112.384453 BSKs are partially redundant positive regulators of brassinosteroid signaling in Arabidopsis.2013 · DOI: 10.1111/tpj.12175 POLAR-guided signalling complex assembly and localization drive asymmetric cell division.2018 · DOI: 10.1038/s41586-018-0714-x
`At4g00720`	May mediate extracellular signals to regulate transcription in differentiating cells.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_015908 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006468 protein phosphorylation Biological Process

GO:0006972 hyperosmotic response Biological Process

GO:0007033 vacuole organization Biological Process

GO:0007165 signal transduction Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009416 response to light stimulus Biological Process

GO:0009553 embryo sac development Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009729 detection of brassinosteroid stimulus Biological Process

GO:0009733 response to auxin Biological Process

GO:0009741 response to brassinosteroid Biological Process

GO:0009742 brassinosteroid mediated signaling pathway Biological Process

KEGG gene cross-reference

ath:AT1G09840

ath:AT1G57870

ath:AT4G00720

ath:AT4G18710

bna:106388722

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.439

Rank 1 · LXL04_015908 · OH-1004

Nucleus0.358

Rank 2 · LXL04_015908 · OH-1004

Mitochondrion0.183

Rank 3 · LXL04_015908 · OH-1004

Endoplasmic reticulum0.091

Rank 4 · LXL04_015908 · OH-1004

Cell membrane0.063

Rank 5 · LXL04_015908 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FVS6`	Arabidopsis thaliana	Shaggy-related protein kinase delta	85.000%	Swiss-Prot	weak database homology
`Q39019`	Arabidopsis thaliana	Shaggy-related protein kinase kappa	82.500%	Swiss-Prot	weak database homology
`Q39011`	Arabidopsis thaliana	Shaggy-related protein kinase eta	71.429%	Swiss-Prot	weak database homology
`Q96287`	Arabidopsis thaliana	Shaggy-related protein kinase theta	73.810%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card