LXL04_015583 | RubberDandelionOmics

Gene overview

LXL04_015583

Reference: OH-1004 Chr: Chr03 Coordinates: 76818556-76830783 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

4353 bp · LXL04_015583|LXL04_015583|OH1004|cDNA

ATGGAGGGTAGGGAGGGATTTAGAGTTAATAGTTCAAACATATGGAGGAACAGTGGTAGAGATTTCTTCTCAAGATCTTCACGTgaagaagacgatgaagaagCATTAAAATGGGCTGCAATTGAACGACTGCCCACTAATCTTCGATTACAGAGAGGCATACTGACCGAAGAAAAAGGCTGCCCGAAAGAGATTAATGTTAAGAATCTTGGATTGGTTGACAGAATGAATCTGTTAGAGAGGCTCGTTAAGATAGCAGA...

CDS

Download CDS FASTA

4353 bp · LXL04_015583|LXL04_015583|OH1004|CDS

ATGGAGGGTAGGGAGGGATTTAGAGTTAATAGTTCAAACATATGGAGGAACAGTGGTAGAGATTTCTTCTCAAGATCTTCACGTGAAGAAGACGATGAAGAAGCATTAAAATGGGCTGCAATTGAACGACTGCCCACTAATCTTCGATTACAGAGAGGCATACTGACCGAAGAAAAAGGCTGCCCGAAAGAGATTAATGTTAAGAATCTTGGATTGGTTGACAGAATGAATCTGTTAGAGAGGCTCGTTAAGATAGCAGA...

Protein

Download Protein FASTA

1450 aa · LXL04_015583|LXL04_015583|OH1004|PROTEIN

MEGREGFRVNSSNIWRNSGRDFFSRSSREEDDEEALKWAAIERLPTNLRLQRGILTEEKGCPKEINVKNLGLVDRMNLLERLVKIAEEDNEKFLMKLKQRIDRVGIRLPTIEVRFEHLNVDAEAYVGGRALPTIFNFLVNILEGSLNYLHLLPSRKKSLPILHDVSGIVKPGRMTLLLGPPSSGKTTLLLALAGKLGSDLQVSGKVTYNGHAMDEFVPQRTSAYISQYDLHIGEMTVRETLAFSARCQGVGANYEMLAEL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_015583`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_015583

Location Chr03:76818556-76830783 (+)

Description Similar to PDR1: Pleiotropic drug resistance protein 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g15520`	May participate in transmembrane ABA import and associated signaling.	PDR-type ABC transporter mediates cellular uptake of the phytohormone abscisic acid.2010 · DOI: 10.1073/pnas.0909222107 ABA transport factors found in Arabidopsis ABC transporters.2010 · DOI: 10.4161/psb.5.9.12566 Arabidopsis Lectin Receptor Kinases LecRK-IX.1 and LecRK-IX.2 Are Functional Analogs in Regulating Phytophthora Resistance and Plant Cell Death.2015 · DOI: 10.1094/mpmi-02-15-0025-r Abscisic acid transporters cooperate to control seed germination.2015 · DOI: 10.1038/ncomms9113

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0609300`	May be a general defense protein.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_015583 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0002229 defense response to oomycetes Biological Process

GO:0009408 response to heat Biological Process

GO:0009409 response to cold Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009723 response to ethylene Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009751 response to salicylic acid Biological Process

GO:0009753 response to jasmonic acid Biological Process

GO:0009914 hormone transport Biological Process

GO:0010193 response to ozone Biological Process

GO:0010496 intercellular transport Biological Process

KEGG gene cross-reference

ath:AT1G15520

dosa:Os01g0609300

nta:107799533

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.683

Rank 1 · LXL04_015583 · OH-1004

Endoplasmic reticulum0.153

Rank 2 · LXL04_015583 · OH-1004

Cytoplasm0.107

Rank 3 · LXL04_015583 · OH-1004

Lysosome / Vacuole0.093

Rank 4 · LXL04_015583 · OH-1004

Golgi apparatus0.066

Rank 5 · LXL04_015583 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14510.12ABC_trans_N87-137 aa

PF00005.34ABC_tran162-344 aa

PF19055.7ABC2_membrane_7377-434 aa

PF01061.30ABC2_membrane507-719 aa

PF08370.17PDR_assoc724-786 aa

PF00005.34ABC_tran881-1033 aa

PF19055.7ABC2_membrane_71062-1122 aa

PF01061.30ABC2_membrane1178-1392 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_015583	`PF14510.12`	ABC_trans_N	87	137	5.4e-08	33.8
LXL04_015583	`PF00005.34`	ABC_tran	162	344	5.3e-40	137.9
LXL04_015583	`PF19055.7`	ABC2_membrane_7	377	434	2.2e-14	53.9
LXL04_015583	`PF01061.30`	ABC2_membrane	507	719	3.3e-108	360.8
LXL04_015583	`PF08370.17`	PDR_assoc	724	786	8.5e-29	99.8
LXL04_015583	`PF00005.34`	ABC_tran	881	1033	5.3e-40	137.9
LXL04_015583	`PF19055.7`	ABC2_membrane_7	1062	1122	2.2e-14	53.9
LXL04_015583	`PF01061.30`	ABC2_membrane	1178	1392	3.3e-108	360.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M9E1`	Arabidopsis thaliana	ABC transporter G family member 40	68.320%	Swiss-Prot	strong database homology
`Q0JLC5`	Oryza sativa subsp. japonica	ABC transporter G family member 36	68.151%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card