LXL04_015185 | RubberDandelionOmics

Gene overview

LXL04_015185

Reference: OH-1004 Chr: Chr03 Coordinates: 65439046-65441847 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1698 bp · LXL04_015185|LXL04_015185|OH1004|cDNA

ATGGCTATCCACCGCCGACGCCACCATTCCCATAGTCATAACCGGTTCCGTTATCTTATTCCGGCGATTTCTGCAATTTCCGCTGCTATTCTCATCCTTTACGGTTTCATCTCTCTGCTTGCACCTTCCCCCGACCATCCCCACCACCTTGTACGGCAGACGACGTCCGATGATGATTCACCTGGAGTTCGTTCAGTTTTCAAAGTTCCGATCAGTGGTGGGATGGCGAGTGATCGAAGTCTATGGAGTACACGGATGTC...

CDS

Download CDS FASTA

1698 bp · LXL04_015185|LXL04_015185|OH1004|CDS

ATGGCTATCCACCGCCGACGCCACCATTCCCATAGTCATAACCGGTTCCGTTATCTTATTCCGGCGATTTCTGCAATTTCCGCTGCTATTCTCATCCTTTACGGTTTCATCTCTCTGCTTGCACCTTCCCCCGACCATCCCCACCACCTTGTACGGCAGACGACGTCCGATGATGATTCACCTGGAGTTCGTTCAGTTTTCAAAGTTCCGATCAGTGGTGGGATGGCGAGTGATCGAAGTCTATGGAGTACACGGATGTC...

Protein

Download Protein FASTA

565 aa · LXL04_015185|LXL04_015185|OH1004|PROTEIN

MAIHRRRHHSHSHNRFRYLIPAISAISAAILILYGFISLLAPSPDHPHHLVRQTTSDDDSPGVRSVFKVPISGGMASDRSLWSTRMSKFYFGCSNASSKFPKVETITYPNRYLLIATSGGLNQQRTGITDAVVAARILNATLVVPKLDQKSFWKDSSTFSEIFDVDWFISHLSKDVKVIKELPKKGGKIWTPYNMRVPRKCNERCYQIRVLPVLLKKHAVQLSKFDYRLSNKLETDLQKLRCRVNYHALKFTDPINKMGQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_015185`
TK1151 ID	TkA02G358210
OH-1004 ID	LXL04_015185
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	97.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_015185

Location Chr03:65439046-65441847 (-)

Description Similar to OFUT16: O-fucosyltransferase 16

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g76270`	O-fucosyltransferase 16.	No verified direct reference in this release
`At1g20550`	O-fucosyltransferase 6.	No verified direct reference in this release
`At4g38390`	Protein ROOT HAIR SPECIFIC 17.	No verified direct reference in this release
`At4g16650`	O-fucosyltransferase 29.	No verified direct reference in this release
`At5g64600`	O-fucosyltransferase 38.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_015185 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006004 fucose metabolic process Biological Process

GO:0000137 Golgi cis cisterna Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005768 endosome Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005802 trans-Golgi network Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0016757 glycosyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT1G20550

ath:AT1G76270

ath:AT4G16650

ath:AT4G38390

ath:AT5G64600

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.807

Rank 1 · LXL04_015185 · OH-1004

Cell membrane0.068

Rank 2 · LXL04_015185 · OH-1004

Endoplasmic reticulum0.067

Rank 3 · LXL04_015185 · OH-1004

Extracellular0.047

Rank 4 · LXL04_015185 · OH-1004

Cytoplasm0.043

Rank 5 · LXL04_015185 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF10250.16O-FucT112-426 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_015185	`PF10250.16`	O-FucT	112	426	6.4e-104	349.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q949U4`	Arabidopsis thaliana	O-fucosyltransferase 16	67.876%	Swiss-Prot	strong database homology
`F4HSU3`	Arabidopsis thaliana	O-fucosyltransferase 6	67.708%	Swiss-Prot	strong database homology
`Q9SVE6`	Arabidopsis thaliana	Protein ROOT HAIR SPECIFIC 17	65.437%	Swiss-Prot	strong database homology
`Q8LPF8`	Arabidopsis thaliana	O-fucosyltransferase 29	61.594%	Swiss-Prot	strong database homology
`F4KF16`	Arabidopsis thaliana	O-fucosyltransferase 38	41.686%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card