LXL04_015134 | RubberDandelionOmics

Gene overview

LXL04_015134

Reference: OH-1004 Chr: Chr03 Coordinates: 64618067-64633119 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3552 bp · LXL04_015134|LXL04_015134|OH1004|cDNA

ATGAAGTTGATTCTCCTTTGTTTATACGCTTCTTTATACTTTCACTGCATCATTGGAACGGTATATCTACCAAAAAATGTCTCCGTATCAGCAATCATAGCATTTGGAGACTCCTTATTGGATGTGGGGAATAACAATTATATTAACACTATGACCAAGTCCAATTTCCTGCCTTATGGAAAGGATTTCGTGGGTGGAAAACCAACCGGGAGGTTCTCGAATGGGAAAACATTAGCGGATTTTTTTGCCAAGGAATTAGG...

CDS

Download CDS FASTA

3552 bp · LXL04_015134|LXL04_015134|OH1004|CDS

ATGAAGTTGATTCTCCTTTGTTTATACGCTTCTTTATACTTTCACTGCATCATTGGAACGGTATATCTACCAAAAAATGTCTCCGTATCAGCAATCATAGCATTTGGAGACTCCTTATTGGATGTGGGGAATAACAATTATATTAACACTATGACCAAGTCCAATTTCCTGCCTTATGGAAAGGATTTCGTGGGTGGAAAACCAACCGGGAGGTTCTCGAATGGGAAAACATTAGCGGATTTTTTTGCCAAGGAATTAGG...

Protein

Download Protein FASTA

1183 aa · LXL04_015134|LXL04_015134|OH1004|PROTEIN

MKLILLCLYASLYFHCIIGTVYLPKNVSVSAIIAFGDSLLDVGNNNYINTMTKSNFLPYGKDFVGGKPTGRFSNGKTLADFFAKELGVKEYVPAYLDPFTKENDLLTGVSFASGGTGYDPLTATLSAVIPVSIQLDLFKQYIWRLKKKIGEKAVKNIITNSVFFVSSSSNDFLVNYYSVPIRRLQYDVAEYSNMLVRLAGNFVQDLHKLGARRIVVFSAPPLGCIPIERTLVGGSKRKCVDEYNKAARLFNGKLKEHLQF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_015134`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_015134

Location Chr03:64618067-64633119 (+)

Description Similar to EXL3: GDSL esterase/lipase EXL3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g75900`	GDSL esterase/lipase EXL3.	No verified direct reference in this release
`At1g75880`	GDSL esterase/lipase EXL1.	No verified direct reference in this release
`UniProt: Q9FHW9`	GDSL esterase/lipase At5g42170.	No verified direct reference in this release
`At1g75890`	GDSL esterase/lipase EXL2.	No verified direct reference in this release
`At3g14820`	GDSL esterase/lipase At3g14820.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_015134 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0016042 lipid catabolic process Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0016298 lipase activity Molecular Function

GO:0016746 acyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT1G75880

ath:AT1G75900

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.249

Rank 1 · LXL04_015134 · OH-1004

Lysosome / Vacuole0.217

Rank 2 · LXL04_015134 · OH-1004

Cytoplasm0.182

Rank 3 · LXL04_015134 · OH-1004

Endoplasmic reticulum0.181

Rank 4 · LXL04_015134 · OH-1004

Cell membrane0.111

Rank 5 · LXL04_015134 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00657.29Lipase_GDSL32-336 aa

PF04844.19Ovate828-875 aa

PF00657.29Lipase_GDSL919-1171 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_015134	`PF00657.29`	Lipase_GDSL	32	336	5.3e-55	187.5
LXL04_015134	`PF04844.19`	Ovate	828	875	9.7e-20	71.1
LXL04_015134	`PF00657.29`	Lipase_GDSL	919	1171	5.3e-55	187.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q94CH6`	Arabidopsis thaliana	GDSL esterase/lipase EXL3	47.941%	Swiss-Prot	weak database homology
`Q94CH8`	Arabidopsis thaliana	GDSL esterase/lipase EXL1	49.527%	Swiss-Prot	weak database homology
`Q9FHW9`	Arabidopsis thaliana	GDSL esterase/lipase At5g42170	48.012%	Swiss-Prot	weak database homology
`Q94CH7`	Arabidopsis thaliana	GDSL esterase/lipase EXL2	48.160%	Swiss-Prot	weak database homology
`Q9LH73`	Arabidopsis thaliana	GDSL esterase/lipase At3g14820	48.742%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card