LXL04_014802 | RubberDandelionOmics

Gene overview

LXL04_014802

Reference: OH-1004 Chr: Chr03 Coordinates: 57253498-57259615 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3675 bp · LXL04_014802|LXL04_014802|OH1004|cDNA

ATGATTATGTGCAGGTTCAAACGGGCTAGGGTTATCAAAATGTACATAAAGCAGGTCATCATTGAAGGGTTTAAGAGCTACAAAGAACAAGTTGCAACTGATGATTTCAGTCCAAAAGTCAACTGTGTTGTTGGTGCAAATGGATCTGGCAAGTCGAATTTCTTTTCAGCAATTCGGTTTGTGATAAGCGACCTCTTTCATAACTTGAGGAATGAAGATAAACACGCCTTCCTCCATGAAGGAGCAGGACACCAAGTTCT...

CDS

Download CDS FASTA

3675 bp · LXL04_014802|LXL04_014802|OH1004|CDS

ATGATTATGTGCAGGTTCAAACGGGCTAGGGTTATCAAAATGTACATAAAGCAGGTCATCATTGAAGGGTTTAAGAGCTACAAAGAACAAGTTGCAACTGATGATTTCAGTCCAAAAGTCAACTGTGTTGTTGGTGCAAATGGATCTGGCAAGTCGAATTTCTTTTCAGCAATTCGGTTTGTGATAAGCGACCTCTTTCATAACTTGAGGAATGAAGATAAACACGCCTTCCTCCATGAAGGAGCAGGACACCAAGTTCT...

Protein

Download Protein FASTA

1224 aa · LXL04_014802|LXL04_014802|OH1004|PROTEIN

MIMCRFKRARVIKMYIKQVIIEGFKSYKEQVATDDFSPKVNCVVGANGSGKSNFFSAIRFVISDLFHNLRNEDKHAFLHEGAGHQVLSAFVEIVFDNSDNRIPVDKEEVHLRRTIGTKKDEYFLDGKHITKTEVMNLLESAGFSRSNPYYVVQQGKIASLTLMKDAERLDLLKEIGGTRVYEERRRESLKIMQETGKNQIIQVVQYLDERLRELDEEKAELKKYQQLDKQRKSLEYTIYDKELNDARKELVEVDNERNAI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_014802`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_014802

Location Chr03:57253498-57259615 (-)

Description Similar to SMC3: Structural maintenance of chromosomes protein 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g27170`	Central component of cohesin, a complex required for chromosome cohesion during the cell cycle.	Condensin and cohesin knockouts in Arabidopsis exhibit a titan seed phenotype.2002 · DOI: 10.1046/j.1365-313x.2002.01224.x Cohesin gene defects may impair sister chromatid alignment and genome stability in Arabidopsis thaliana.2009 · DOI: 10.1007/s00412-009-0220-x

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014802 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000278 mitotic cell cycle Biological Process

GO:0006275 regulation of DNA replication Biological Process

GO:0006281 DNA repair Biological Process

GO:0007059 chromosome segregation Biological Process

GO:0007062 sister chromatid cohesion Biological Process

GO:0007064 mitotic sister chromatid cohesion Biological Process

GO:0019827 stem cell population maintenance Biological Process

GO:0051301 cell division Biological Process

GO:0051321 meiotic cell cycle Biological Process

GO:0090307 mitotic spindle assembly Biological Process

GO:0000775 chromosome, centromeric region Cellular Component

GO:0000785 chromatin Cellular Component

KEGG gene cross-reference

ani:ANIA_06364

ath:AT2G27170

bta:281729

mmu:13006

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.894

Rank 1 · LXL04_014802 · OH-1004

Cytoplasm0.182

Rank 2 · LXL04_014802 · OH-1004

Cell membrane0.023

Rank 3 · LXL04_014802 · OH-1004

Mitochondrion0.019

Rank 4 · LXL04_014802 · OH-1004

Endoplasmic reticulum0.012

Rank 5 · LXL04_014802 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13175.13AAA_1514-425 aa

PF02463.26SMC_N15-1200 aa

PF13476.13AAA_2319-292 aa

PF13304.13AAA_2140-64 aa

PF06470.19SMC_hinge533-645 aa

PF13304.13AAA_211068-1179 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_014802	`PF13175.13`	AAA_15	14	425	1.4e-09	38.7
LXL04_014802	`PF02463.26`	SMC_N	15	1200	8.1e-66	222.3
LXL04_014802	`PF13476.13`	AAA_23	19	292	8.8e-10	40.3
LXL04_014802	`PF13304.13`	AAA_21	40	64	4.8e-16	60.3
LXL04_014802	`PF06470.19`	SMC_hinge	533	645	3.6e-27	95.8
LXL04_014802	`PF13304.13`	AAA_21	1068	1179	4.8e-16	60.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q56YN8`	Arabidopsis thaliana	Structural maintenance of chromosomes protein 3	65.239%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card