LXL04_014689 | RubberDandelionOmics

Gene overview

LXL04_014689

Reference: OH-1004 Chr: Chr03 Coordinates: 55017715-55019872 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1170 bp · LXL04_014689|LXL04_014689|OH1004|cDNA

ATGGGAGCTCAGAAGAGCGTCCATGCTGGCAAAGCCAAGATAGACTTCAATGTTGATTTCACGCACAGGCTATGTGCTGCTATGATGGTACATTCGTTCAGAAATTCAGGCACTGGTAGTCCGCTTTCACTGATTGTTGGGAGCCTTTGCATAAAACACCCAAACCTATTTGGAAAAAGCGAGAAGCTTGATCTATTATGGGATAAAGGCCTTTCAGATTCCAATATATTGATTGCTTATAGAAAGCCAAGACCCGAATG...

CDS

Download CDS FASTA

1170 bp · LXL04_014689|LXL04_014689|OH1004|CDS

ATGGGAGCTCAGAAGAGCGTCCATGCTGGCAAAGCCAAGATAGACTTCAATGTTGATTTCACGCACAGGCTATGTGCTGCTATGATGGTACATTCGTTCAGAAATTCAGGCACTGGTAGTCCGCTTTCACTGATTGTTGGGAGCCTTTGCATAAAACACCCAAACCTATTTGGAAAAAGCGAGAAGCTTGATCTATTATGGGATAAAGGCCTTTCAGATTCCAATATATTGATTGCTTATAGAAAGCCAAGACCCGAATG...

Protein

Download Protein FASTA

389 aa · LXL04_014689|LXL04_014689|OH1004|PROTEIN

MGAQKSVHAGKAKIDFNVDFTHRLCAAMMVHSFRNSGTGSPLSLIVGSLCIKHPNLFGKSEKLDLLWDKGLSDSNILIAYRKPRPEWLAQHSFVIQHVTSPEVGIHGVPIDNFSKTGSGGVNLCRFSAGLDLDEPGTSNWTTKTSIKFEHVRPVNDDGRSINRDPHGYSVTSRQSPIFFIFYFQICVDKFVYLHKSYKCSGNFHDNMVVLKQESRFAKANDHSFTRFSLQIEQGIPLMSKWLIFNRFKFAASKGLKVGPG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_014689`
TK1151 ID	TkA02G404600
OH-1004 ID	LXL04_014689
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	92.300
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_014689

Location Chr03:55017715-55019872 (+)

Description Similar to P39: Outer envelope protein 39, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g44160`	Beta-barrel pore-forming protein which possesses voltage-dependent channel activity.	No verified direct reference in this release
`At3g48620`	May play a role during plastid development.	No verified direct reference in this release
`At5g19620`	Plays an essential role during early stages of plastid development.	The Omp85-related chloroplast outer envelope protein OEP80 is essential for viability in Arabidopsis.2008 · DOI: 10.1104/pp.108.122754

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2X208`	Outer envelope protein 80, chloroplastic.	No verified direct reference in this release
`Os02g0196300`	Outer envelope protein 80, chloroplastic.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014689 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009658 chloroplast organization Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0030162 regulation of proteolysis Biological Process

GO:1900057 positive regulation of leaf senescence Biological Process

GO:1901002 positive regulation of response to salt stress Biological Process

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0009707 chloroplast outer membrane Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0016020 membrane Cellular Component

GO:0032991 protein-containing complex Cellular Component

GO:0015267 channel activity Molecular Function

KEGG gene cross-reference

ath:AT3G44160

ath:AT3G48620

ath:AT5G19620

dosa:Os02g0196300

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.653

Rank 1 · LXL04_014689 · OH-1004

Mitochondrion0.192

Rank 2 · LXL04_014689 · OH-1004

Cytoplasm0.097

Rank 3 · LXL04_014689 · OH-1004

Lysosome / Vacuole0.046

Rank 4 · LXL04_014689 · OH-1004

Endoplasmic reticulum0.040

Rank 5 · LXL04_014689 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01103.30Omp8555-385 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_014689	`PF01103.30`	Omp85	55	385	1.7e-28	100.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q5PP51`	Arabidopsis thaliana	Protein SUPPRESSOR OF PPI1 LOCUS 2, chloroplastic	66.838%	Swiss-Prot	strong database homology
`F4JF35`	Arabidopsis thaliana	Outer envelope protein 36, chloroplastic	53.271%	Swiss-Prot	strong database homology
`Q9C5J8`	Arabidopsis thaliana	Outer envelope protein 80, chloroplastic	34.656%	Swiss-Prot	moderate database homology
`A2X208`	Oryza sativa subsp. indica	Outer envelope protein 80, chloroplastic	34.392%	Swiss-Prot	moderate database homology
`Q6H7M7`	Oryza sativa subsp. japonica	Outer envelope protein 80, chloroplastic	34.656%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card