Gene Card
Gene overview
cDNA / CDS / Protein Sequences
756 bp · LXL04_014578|LXL04_014578|OH1004|cDNA
ATGGTTGGCTTGGGGAGCCGGTCGCGagaggaagaagagaagagacAAGGGGGGCCTCCTTGGGTGTTCGGGAGTCCCGACGCCTCTTCCCTTCTTCCCGAAATCGACCTACACCCTCTTCCCGAAGTCGACGCTAGCTGCCCTTCTTCCGCCTATTTTGGAACTTCAACACTGCAACGACCATGCACCGGCCGCCGATGCTGCTACAGGGCCACCGACAGGGAACCACAGTACTCGATTGATTTCAATGTTGATATTCC...
756 bp · LXL04_014578|LXL04_014578|OH1004|CDS
ATGGTTGGCTTGGGGAGCCGGTCGCGAGAGGAAGAAGAGAAGAGACAAGGGGGGCCTCCTTGGGTGTTCGGGAGTCCCGACGCCTCTTCCCTTCTTCCCGAAATCGACCTACACCCTCTTCCCGAAGTCGACGCTAGCTGCCCTTCTTCCGCCTATTTTGGAACTTCAACACTGCAACGACCATGCACCGGCCGCCGATGCTGCTACAGGGCCACCGACAGGGAACCACAGTACTCGATTGATTTCAATGTTGATATTCC...
Protein
Download Protein FASTA251 aa · LXL04_014578|LXL04_014578|OH1004|PROTEIN
MVGLGSRSREEEEKRQGGPPWVFGSPDASSLLPEIDLHPLPEVDASCPSSAYFGTSTLQRPCTGRRCCYRATDREPQYSIDFNVDIPPPNLFEQEKEVLEIPKNETDLGVVEEPPLVPSEIEASKDEKPVVKEADVWTLNAKIKEEKDPTFSATAGLQTIVSSDQINENGHAVNSDEKPPFVVDSDGSIPFYTLAAYEEFSDSNAGNIYLLWKVKAGNSYYRYCVVVKNMQRCMYAIPNCPVFEDSCHFEP
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_014578 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_014578 | ||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr03:52862189-52864799 (-) | ||||||||||||
| Description | Similar to POLA: DNA polymerase alpha catalytic subunit | ||||||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
Rice
| ||||||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | ||||||||||||
| GO annotations (OH1004 source) | GO:0000731 DNA synthesis involved in DNA repair Biological Process GO:0006270 DNA replication initiation Biological Process GO:0006272 leading strand elongation Biological Process GO:0006273 lagging strand elongation Biological Process GO:0009965 leaf morphogenesis Biological Process GO:1902975 mitotic DNA replication initiation Biological Process GO:0005634 nucleus Cellular Component GO:0005658 alpha DNA polymerase:primase complex Cellular Component GO:0000166 nucleotide binding Molecular Function GO:0003682 chromatin binding Molecular Function GO:0003688 DNA replication origin binding Molecular Function GO:0003697 single-stranded DNA binding Molecular Function | ||||||||||||
| KEGG gene cross-reference | ath:AT5G67100 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
No result was found for this query.
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.