LXL04_014493 | RubberDandelionOmics

Gene overview

LXL04_014493

Reference: OH-1004 Chr: Chr03 Coordinates: 50471716-50479077 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

4554 bp · LXL04_014493|LXL04_014493|OH1004|cDNA

ATGGGTTTTCTCCGACTTTTCGTCTTGGCATTCATCGCAACAATTGCTTCTTTCACCATTAATGCCGATGAATCCCCTAAGCTAAACGATGAAGTTTTGGGACTTATAGTCTTCAAATCGTCTCTTACAGACCCATCATCACATTTATCTTCATGGAACCAAGATGATGAAACCCCATGTTCTTGGCAGTTCGTTACCTGCAACCCGGTCACTAGCAGGGTCACCGGACTTTCTCTTGACGGATTGAATCTTTCCGGGAA...

CDS

Download CDS FASTA

4554 bp · LXL04_014493|LXL04_014493|OH1004|CDS

ATGGGTTTTCTCCGACTTTTCGTCTTGGCATTCATCGCAACAATTGCTTCTTTCACCATTAATGCCGATGAATCCCCTAAGCTAAACGATGAAGTTTTGGGACTTATAGTCTTCAAATCGTCTCTTACAGACCCATCATCACATTTATCTTCATGGAACCAAGATGATGAAACCCCATGTTCTTGGCAGTTCGTTACCTGCAACCCGGTCACTAGCAGGGTCACCGGACTTTCTCTTGACGGATTGAATCTTTCCGGGAA...

Protein

Download Protein FASTA

1517 aa · LXL04_014493|LXL04_014493|OH1004|PROTEIN

MGFLRLFVLAFIATIASFTINADESPKLNDEVLGLIVFKSSLTDPSSHLSSWNQDDETPCSWQFVTCNPVTSRVTGLSLDGLNLSGKIGRGLEKLQNLKVLSLAYNNFTGNINHELSLLPNLEQLNLSKNGFSNRIPGSLMSSGSIKFLDLSENSLSGPVSEEFFINCLSLRSLSLSGNNLEGPIPSSLSNCTTLNHLDLSNNRFSGNPDFKSGIWSMIRIRTLDLSHNSFSGSIPNGVFALHDLKELLLQGNDFTGALP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_014493`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_014493

Location Chr03:50471716-50479077 (-)

Description Similar to At3g28040: Probably inactive leucine-rich repeat receptor-like protein kinase At3g28040

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g28040`	Probably inactive leucine-rich repeat receptor-like protein kinase At3g28040.	No verified direct reference in this release
`At2g31500`	May play a role in signal transduction pathways that involve calcium as a second messenger.	No verified direct reference in this release
`At3g56370`	Probable LRR receptor-like serine/threonine-protein kinase IRK.	No verified direct reference in this release
`At5g01890`	Leucine-rich repeat receptor-like protein kinase that may play a role in vascular tissues development.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os07g0568600`	May play a role in signal transduction pathways that involve calcium as a second messenger.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014493 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0035556 intracellular signal transduction Biological Process

GO:0048364 root development Biological Process

GO:0051302 regulation of cell division Biological Process

GO:0080092 regulation of pollen tube growth Biological Process

GO:0090511 periclinal cell division Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0004672 protein kinase activity Molecular Function

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0004683 calcium/calmodulin-dependent protein kinase activity Molecular Function

GO:0005509 calcium ion binding Molecular Function

KEGG gene cross-reference

ath:AT2G31500

ath:AT3G28040

ath:AT3G56370

dosa:Os07g0568600

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.826

Rank 1 · LXL04_014493 · OH-1004

Endoplasmic reticulum0.087

Rank 2 · LXL04_014493 · OH-1004

Cytoplasm0.084

Rank 3 · LXL04_014493 · OH-1004

Nucleus0.070

Rank 4 · LXL04_014493 · OH-1004

Lysosome / Vacuole0.029

Rank 5 · LXL04_014493 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08263.18LRRNT_228-68 aa

PF13855.13LRR_892-131 aa

PF29594.1LRR_SKP2145-298 aa

PF13855.13LRR_8149-205 aa

PF23598.2LRR_14171-293 aa

PF23598.2LRR_14221-321 aa

PF13855.13LRR_8267-327 aa

PF13855.13LRR_8364-423 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_014493	`PF08263.18`	LRRNT_2	28	68	9.4e-14	52.1
LXL04_014493	`PF13855.13`	LRR_8	92	131	1.9e-45	153.1
LXL04_014493	`PF29594.1`	LRR_SKP2	145	298	4.7e-12	46.5
LXL04_014493	`PF13855.13`	LRR_8	149	205	1.9e-45	153.1
LXL04_014493	`PF23598.2`	LRR_14	171	293	1.6e-27	96.9
LXL04_014493	`PF23598.2`	LRR_14	221	321	1.6e-27	96.9
LXL04_014493	`PF13855.13`	LRR_8	267	327	1.9e-45	153.1
LXL04_014493	`PF13855.13`	LRR_8	364	423	1.9e-45	153.1
LXL04_014493	`PF13855.13`	LRR_8	391	447	1.9e-45	153.1
LXL04_014493	`PF23598.2`	LRR_14	409	563	1.6e-27	96.9
LXL04_014493	`PF12799.14`	LRR_4	412	446	6.1e-28	96.9
LXL04_014493	`PF13855.13`	LRR_8	508	567	1.9e-45	153.1
LXL04_014493	`PF00069.32`	Pkinase	751	963	4.6e-108	361.3
LXL04_014493	`PF07714.24`	PK_Tyr_Ser-Thr	761	965	6.1e-57	193.6
LXL04_014493	`PF00069.32`	Pkinase	1042	1300	4.6e-108	361.3
LXL04_014493	`PF07714.24`	PK_Tyr_Ser-Thr	1043	1294	6.1e-57	193.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LRT1`	Arabidopsis thaliana	Probably inactive leucine-rich repeat receptor-like protein kinase At3g28040	59.663%	Swiss-Prot	moderate database homology
`Q9SIQ7`	Arabidopsis thaliana	Calcium-dependent protein kinase 24	60.662%	Swiss-Prot	weak database homology
`Q9LY03`	Arabidopsis thaliana	Probable LRR receptor-like serine/threonine-protein kinase IRK	40.481%	Swiss-Prot	moderate database homology
`Q9LZV7`	Arabidopsis thaliana	Leucine-rich repeat receptor-like protein kinase PXC2	40.120%	Swiss-Prot	moderate database homology
`Q84SL0`	Oryza sativa subsp. japonica	Calcium-dependent protein kinase 20	62.963%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card