Gene Card
Gene overview
cDNA / CDS / Protein Sequences
4044 bp · LXL04_014365|LXL04_014365|OH1004|cDNA
ATGGCGGTTTCAGAGGAGGAATCATCGTCGGCGAGTGGAAACAACTCAAGATCACCGCTGCCCCACGGTGGCCCTCACTACCTTGCTAAATGTGTTCTCAAAGGAAGCGTTGTTCTTCAAGTCGTCTACGGTCACATCCGATCCCCTTCCTCTAAGGACATCGTTTTCGGCAAGGAAACATCCTTAGAGTTGGTAGTAATCGATGATTATGGAGTCCTCCAGTCCATATGTGAGCAGCCTGTATTTGGAACAATCAAAGA...
4044 bp · LXL04_014365|LXL04_014365|OH1004|CDS
ATGGCGGTTTCAGAGGAGGAATCATCGTCGGCGAGTGGAAACAACTCAAGATCACCGCTGCCCCACGGTGGCCCTCACTACCTTGCTAAATGTGTTCTCAAAGGAAGCGTTGTTCTTCAAGTCGTCTACGGTCACATCCGATCCCCTTCCTCTAAGGACATCGTTTTCGGCAAGGAAACATCCTTAGAGTTGGTAGTAATCGATGATTATGGAGTCCTCCAGTCCATATGTGAGCAGCCTGTATTTGGAACAATCAAAGA...
Protein
Download Protein FASTA1347 aa · LXL04_014365|LXL04_014365|OH1004|PROTEIN
MAVSEEESSSASGNNSRSPLPHGGPHYLAKCVLKGSVVLQVVYGHIRSPSSKDIVFGKETSLELVVIDDYGVLQSICEQPVFGTIKDIAILPWNKRFHSARPQVQGKDLLLVTSDSGKLSVLTFSNEMHRFFPLTQVQLSSSPGNLRHHVGTMLAVDANGCFIATSAFEDRLAMFSVSSSVGANIIDKKVFFPSETEKNTSTSTNTRVPGIHGTIWSMCFISKDMSQSQPSKEHNPLLAVLINRKGSLYNEILLLEWNTR...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_014365 |
|---|---|
| TK1151 ID | TkA02G433590 |
| OH-1004 ID | LXL04_014365 |
| Relationship / confidence | Sequence Supported Annotation Or Model Conflict / Review |
| Protein identity (%) | 99.500 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 48.255Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_014365 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr03:47520407-47525783 (-) | |||||||||
| Description | Similar to DDB1B: DNA damage-binding protein 1b | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0000398 mRNA splicing, via spliceosome Biological Process GO:0006281 DNA repair Biological Process GO:0009585 red, far-red light phototransduction Biological Process GO:0009793 embryo development ending in seed dormancy Biological Process GO:0016567 protein ubiquitination Biological Process GO:0042752 regulation of circadian rhythm Biological Process GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process Biological Process GO:0045892 negative regulation of DNA-templated transcription Biological Process GO:0045893 positive regulation of DNA-templated transcription Biological Process GO:0048511 rhythmic process Biological Process GO:0000124 SAGA complex Cellular Component GO:0005634 nucleus Cellular Component | |||||||||
| KEGG gene cross-reference | ath:AT4G05420 ath:AT4G21100 dme:Dmel_CG13900 gga:374050 xla:399026 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF10433.16Beta-prop_RSE1_1st38-479 aaPF23726.2Beta-prop_RSE1_2nd532-885 aaPF03178.22CPSF_A930-1305 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_014365 | PF10433.16 | Beta-prop_RSE1_1st | 38 | 479 | 1.8e-43 | 149.7 |
| LXL04_014365 | PF23726.2 | Beta-prop_RSE1_2nd | 532 | 885 | 4.7e-33 | 115.6 |
| LXL04_014365 | PF03178.22 | CPSF_A | 930 | 1305 | 2.1e-34 | 120.0 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.