LXL04_014303 | RubberDandelionOmics

Gene overview

LXL04_014303

Reference: OH-1004 Chr: Chr03 Coordinates: 45648416-45650028 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

590 bp · LXL04_014303|LXL04_014303|OH1004|cDNA

ATGTGTGACATTGATGAGGAGGTGGTTGAATTTTGCAAGTCGTATTTAGTAGTTAACAGTGAAGCTTTCTATGATCCAAGGCTTGAGCTCATTATCAACGACGCTAGGGCGGAACTGGAGAAGAGAGAGGATAAATACGATGTGATGATAGGAGATTTGACAGACCCACTTGAAGGGGGTCCATGTAACCAACTTTATACCAACACGTTCTATGAACTTACCGTCAAACCAAAACTCAAGGAGGGTGGTATTTTTGTCAC...

CDS

Download CDS FASTA

381 bp · LXL04_014303|LXL04_014303|OH1004|CDS

ATGTGTGACATTGATGAGGAGGTGGTTGAATTTTGCAAGTCGTATTTAGTAGTTAACAGTGAAGCTTTCTATGATCCAAGGCTTGAGCTCATTATCAACGACGCTAGGGCGGAACTGGAGAAGAGAGAGGATAAATACGATGTGATGATAGGAGATTTGACAGACCCACTTGAAGGGGGTCCATGTAACCAACTTTATACCAACACGTTCTATGAACTTACCGTCAAACCAAAACTCAAGGAGGGTGGTATTTTTGTCAC...

Protein

Download Protein FASTA

126 aa · LXL04_014303|LXL04_014303|OH1004|PROTEIN

MCDIDEEVVEFCKSYLVVNSEAFYDPRLELIINDARAELEKREDKYDVMIGDLTDPLEGGPCNQLYTNTFYELTVKPKLKEGGIFVTQAGPADVLTHTGLSICIFNTLKQVFKCLCRRSIPSSFNR

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_014303`
TK1151 ID	TkA02G440800
OH-1004 ID	LXL04_014303
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	92.500
Protein coverage (%)	TK1151 57.416 / OH-1004 92.063 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_014303

Location Chr03:45648416-45650028 (-)

Description Similar to ACL5: Thermospermine synthase ACAULIS5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g19530`	Required for correct xylem specification through regulation of the lifetime of the xylem elements.	ACAULIS5, an Arabidopsis gene required for stem elongation, encodes a spermine synthase.2000 · DOI: 10.1093/emboj/19.16.4248 ACAULIS5 controls Arabidopsis xylem specification through the prevention of premature cell death.2008 · DOI: 10.1242/dev.019349 Thermospermine is required for stem elongation in Arabidopsis thaliana.2008 · DOI: 10.1093/pcp/pcn109

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014303 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006596 polyamine biosynthetic process Biological Process

GO:0008295 spermidine biosynthetic process Biological Process

GO:0009926 auxin polar transport Biological Process

GO:0010087 phloem or xylem histogenesis Biological Process

GO:0048759 xylem vessel member cell differentiation Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0004766 spermidine synthase activity Molecular Function

GO:0010487 thermospermine synthase activity Molecular Function

GO:0016768 spermine synthase activity Molecular Function

GO:0043919 agmatine aminopropyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT5G19530

tth:TT_C0472

ttj:TTHA0824

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.675

Rank 1 · LXL04_014303 · OH-1004

Nucleus0.362

Rank 2 · LXL04_014303 · OH-1004

Extracellular0.071

Rank 3 · LXL04_014303 · OH-1004

Mitochondrion0.053

Rank 4 · LXL04_014303 · OH-1004

Peroxisome0.048

Rank 5 · LXL04_014303 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01564.24Spermine_synth1-116 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_014303	`PF01564.24`	Spermine_synth	1	116	1.3e-23	84.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9S7X6`	Arabidopsis thaliana	Thermospermine synthase ACL5	62.832%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card