LXL04_014246 | RubberDandelionOmics

Gene overview

LXL04_014246

Reference: OH-1004 Chr: Chr03 Coordinates: 44442276-44445520 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1710 bp · LXL04_014246|LXL04_014246|OH1004|cDNA

ATGCTGGTTCAAATTGTGGTGAAGATGTTTGAGATAGTGGGGAATGTGTATGAAATTGAGGGGAAGGGGAAGGTGTTTGATACTGCGGTGTGGGATTTTCTGGttgttgatactgatactgGTGTGTTGGATACTGCGGTGTGGGATAttgtggttgttgatactgatactgatactgtggttgtgTTTGCATCCAAGCTTGAAACGCCAGATTTTGTTGATGTAGCGAATAAAGCTGCAAATACTCTAAGAAACCACCG...

CDS

Download CDS FASTA

1710 bp · LXL04_014246|LXL04_014246|OH1004|CDS

ATGCTGGTTCAAATTGTGGTGAAGATGTTTGAGATAGTGGGGAATGTGTATGAAATTGAGGGGAAGGGGAAGGTGTTTGATACTGCGGTGTGGGATTTTCTGGTTGTTGATACTGATACTGGTGTGTTGGATACTGCGGTGTGGGATATTGTGGTTGTTGATACTGATACTGATACTGTGGTTGTGTTTGCATCCAAGCTTGAAACGCCAGATTTTGTTGATGTAGCGAATAAAGCTGCAAATACTCTAAGAAACCACCG...

Protein

Download Protein FASTA

569 aa · LXL04_014246|LXL04_014246|OH1004|PROTEIN

MLVQIVVKMFEIVGNVYEIEGKGKVFDTAVWDFLVVDTDTGVLDTAVWDIVVVDTDTDTVVVFASKLETPDFVDVANKAANTLRNHRRGPAAVLCRWKGLPLASPIPRPSPAVNSQNSHTAGFIPTSLTLKYSFQKIYILLRCRKKLIFSVKVGVAGFSMGAAVALYSATCRALGQYGNGNRYPINLSAAVALRPTPMDLQNSVGVGLSGWLPCSRNLRNRWEHHKKLQGVQHSSLPILLCHGKGKRKRDKQKLCFLDWW...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_014246`
TK1151 ID	TkA07G251340
OH-1004 ID	LXL04_014246
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	48.800
Protein coverage (%)	TK1151 75.771 / OH-1004 22.320 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_014246`
Location	Chr03:44442276-44445520 (+)
Description	Similar to Retrovirus-related Pol polyprotein from transposon TNT 1-94
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_014246` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0006508 proteolysis Biological Process GO:0015074 DNA integration Biological Process GO:0003676 nucleic acid binding Molecular Function GO:0003964 RNA-directed DNA polymerase activity Molecular Function GO:0004190 aspartic-type endopeptidase activity Molecular Function GO:0004519 endonuclease activity Molecular Function GO:0008270 zinc ion binding Molecular Function
KEGG gene cross-reference	No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.431

Rank 1 · LXL04_014246 · OH-1004

Nucleus0.298

Rank 2 · LXL04_014246 · OH-1004

Endoplasmic reticulum0.137

Rank 3 · LXL04_014246 · OH-1004

Mitochondrion0.111

Rank 4 · LXL04_014246 · OH-1004

Cell membrane0.088

Rank 5 · LXL04_014246 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13961.13DUF4219303-325 aa

PF14223.15Retrotran_gag_2312-477 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_014246	`PF13961.13`	DUF4219	303	325	2.3e-06	27.9
LXL04_014246	`PF14223.15`	Retrotran_gag_2	312	477	3.2e-16	60.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card