LXL04_014200 | RubberDandelionOmics

Gene overview

LXL04_014200

Reference: OH-1004 Chr: Chr03 Coordinates: 43583699-43585369 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

701 bp · LXL04_014200|LXL04_014200|OH1004|cDNA

ATTCACAAGTGGACCGACTTCCTCCTTCCCATTCCCTCCACGTATCTCTTTCTCTCACGTTATCTTTCCAATTCATCATCATCTGTACGTTCGTTATAATCAAACCCATTAACGCCAACTCACCTTTCCTGAAACCCCACATGGAAGACGCTAACGTTGTTGAAGCTAAAGATGGAGCCATCGCTGTTGCCTCTGCTTTTGCTGGCCACCAGGAAGTTGTGAAGGATCGAGACCACAAATTCCTGACAAGAGCTGTTGAA...

CDS

Download CDS FASTA

573 bp · LXL04_014200|LXL04_014200|OH1004|CDS

CTGAAACCCCACATGGAAGACGCTAACGTTGTTGAAGCTAAAGATGGAGCCATCGCTGTTGCCTCTGCTTTTGCTGGCCACCAGGAAGTTGTGAAGGATCGAGACCACAAATTCCTGACAAGAGCTGTTGAAGAAGCTTACAAAGGAGTTGATTGTGGAGATGGAGGCCCATTTGGGGCTGTTGTGGTTCGTAACGATGAAGTTGTTGTGAGTTGCCATAACATGGTTCTAAAACACACCGATCCAACTGCACATGCTGA...

Protein

Download Protein FASTA

190 aa · LXL04_014200|LXL04_014200|OH1004|PROTEIN

MKPHMEDANVVEAKDGAIAVASAFAGHQEVVKDRDHKFLTRAVEEAYKGVDCGDGGPFGAVVVRNDEVVVSCHNMVLKHTDPTAHAEVTAIREACKKLNQIELSDCEIYASCEPCPMCFGAIHLSRIKRLVYGAKAEAAIAIGFDDFIADALRGTGFYQKANLEIKKADGNGAMIAEQVFEKTKAKFAMY

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_014200`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_014200

Location Chr03:43583699-43585369 (+)

Description Similar to GSDA: Guanosine deaminase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g28050`	Catalyzes the hydrolytic deamination of guanosine, producing xanthosine and ammonia.	Plant purine nucleoside catabolism employs a guanosine deaminase required for the generation of xanthosine in Arabidopsis.2013 · DOI: 10.1105/tpc.113.117184

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014200 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0002100 tRNA wobble adenosine to inosine editing Biological Process

GO:0006147 guanine catabolic process Biological Process

GO:0006152 purine nucleoside catabolic process Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009536 plastid Cellular Component

GO:0008270 zinc ion binding Molecular Function

GO:0008892 guanine deaminase activity Molecular Function

GO:0047974 guanosine deaminase activity Molecular Function

GO:0052717 tRNA-specific adenosine-34 deaminase activity Molecular Function

KEGG gene cross-reference

aae:aq_903

ath:AT5G28050

bsu:BSU00180

bsu:BSU13170

sav:SAV0558

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.559

Rank 1 · LXL04_014200 · OH-1004

Nucleus0.471

Rank 2 · LXL04_014200 · OH-1004

Cell membrane0.145

Rank 3 · LXL04_014200 · OH-1004

Endoplasmic reticulum0.067

Rank 4 · LXL04_014200 · OH-1004

Mitochondrion0.054

Rank 5 · LXL04_014200 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00383.30dCMP_cyt_deam_134-133 aa

PF14437.13MafB19-deam38-182 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_014200	`PF00383.30`	dCMP_cyt_deam_1	34	133	8.7e-28	96.9
LXL04_014200	`PF14437.13`	MafB19-deam	38	182	3.3e-21	76.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q94BU8`	Arabidopsis thaliana	Guanosine deaminase	84.946%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card